PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 233aa    MW: 25455.5 Da    PI: 5.3583
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM48.62.6e-15251661128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkk...lelee.vikevdiykvePwdLp.kkvkaeek..ew.yfFskrdkkya.......tgkrknratks 80 
                     +p+G+ F+ +   l+++yL + + + +    ++ + v + vd+y + P+ Lp  +++ +++   w yfF++r  ++        +g+  + +++ 
  Pahal.G00600.1  25 MPRGYVFQSKARCLLDYYLVPMALHGRvaeRNIRDsVAQGVDVYALRPEALPfLRCNRDRTgqVWgYFFATRPAAAGgssagssHGDDVREVAAG 119
                     6899***************9998888855422322268999***********64444433333779****9999887555554344455557899 PP

             NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     g W+  g + e + ++ge+   ++ ++f+ +    g+kt W m+e+rl
  Pahal.G00600.1 120 GCWRRYGGEVEYVGEDGEAYAFRRRFAFH-EAGDGGNKTVWRMKEFRL 166
                     *********999999**************.5677889*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-1721191IPR003441NAC domain
PROSITE profilePS5100520.64125193IPR003441NAC domain
PfamPF023653.8E-826166IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAQPPEATTA PVPALDRTPW SISEMPRGYV FQSKARCLLD YYLVPMALHG RVAERNIRDS  60
VAQGVDVYAL RPEALPFLRC NRDRTGQVWG YFFATRPAAA GGSSAGSSHG DDVREVAAGG  120
CWRRYGGEVE YVGEDGEAYA FRRRFAFHEA GDGGNKTVWR MKEFRLNMAA SAFHGVAFHP  180
RAKGLAIWKV YNEPIPDPED EPAVDYYNSD DENGAIVITV GDAIVDPPAP AA*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826306.11e-171uncharacterized protein LOC112901581
TrEMBLA0A2S3I7R41e-169A0A2S3I7R4_9POAL; Uncharacterized protein
STRINGSb06g019930.12e-78(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128912231