PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00491.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 322aa    MW: 34705.1 Da    PI: 8.0151
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00491.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.5e-5331281128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++kv+++++ +  ++ e+d++k+ePwdLp+ +k +ekewyfF+ +d+ky+tg r+nrat++gyWkatgkdk++++ 
  Pahal.G00491.3   3 LPPGFRFHPTDEELITHYLARKVADTRFAA-LAVGEADLNKSEPWDLPSLAKMGEKEWYFFCLKDRKYPTGLRTNRATEAGYWKATGKDKDIFR- 95 
                     79*************************999.67***************8888899***************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++lvg kktLvfy+grapkgek+ Wvmheyrl
  Pahal.G00491.3  96 GKALVGSKKTLVFYTGRAPKGEKSGWVMHEYRL 128
                     99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-622154IPR003441NAC domain
PROSITE profilePS5100558.3963154IPR003441NAC domain
PfamPF023654.9E-294128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MELPPGFRFH PTDEELITHY LARKVADTRF AALAVGEADL NKSEPWDLPS LAKMGEKEWY  60
FFCLKDRKYP TGLRTNRATE AGYWKATGKD KDIFRGKALV GSKKTLVFYT GRAPKGEKSG  120
WVMHEYRLHG KLPGAVPRTA SAKNEWVLCR VFKKSLVAGV APAAKRGAME MDDIASISHL  180
PPLMDVSSGA AAVGCNPAAA HVTCFSNALE GQFFNQTAPP QAAASATDHL GLASSSPFLS  240
SFTQYGPLHH GGVSLVQLLE SSGYGGGGDL PDMPKQQQQQ QGGGERERLS ASQDTGLTSD  300
AHPEISSSSG QRFDTEQLWG Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-53115415165NO APICAL MERISTEM PROTEIN
1ut4_B6e-53115415165NO APICAL MERISTEM PROTEIN
1ut7_A6e-53115415165NO APICAL MERISTEM PROTEIN
1ut7_B6e-53115415165NO APICAL MERISTEM PROTEIN
3swm_A6e-53115418168NAC domain-containing protein 19
3swm_B6e-53115418168NAC domain-containing protein 19
3swm_C6e-53115418168NAC domain-containing protein 19
3swm_D6e-53115418168NAC domain-containing protein 19
3swp_A6e-53115418168NAC domain-containing protein 19
3swp_B6e-53115418168NAC domain-containing protein 19
3swp_C6e-53115418168NAC domain-containing protein 19
3swp_D6e-53115418168NAC domain-containing protein 19
4dul_A6e-53115415165NAC domain-containing protein 19
4dul_B6e-53115415165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0607700.0BT060770.2 Zea mays full-length cDNA clone ZM_BFb0046M18 mRNA, complete cds.
GenBankBT0635430.0BT063543.1 Zea mays full-length cDNA clone ZM_BFc0075B16 mRNA, complete cds.
GenBankBT0844930.0BT084493.2 Zea mays full-length cDNA clone ZM_BFb0122M24 mRNA, complete cds.
GenBankJX4285300.0JX428530.1 Zea mays subsp. mays clone pUT3130 NAC32 NAC type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826317.10.0NAC domain-containing protein 92-like
RefseqXP_025826319.10.0NAC domain-containing protein 92-like
RefseqXP_025826320.10.0NAC domain-containing protein 92-like
RefseqXP_025826321.10.0NAC domain-containing protein 92-like
SwissprotQ9FLJ26e-94NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A2S3I8340.0A0A2S3I834_9POAL; Uncharacterized protein
STRINGPavir.Gb01850.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.16e-94NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]