PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 620aa    MW: 70410 Da    PI: 5.822
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00340.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS280.84e-862406112373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lL++cA+av++++   a +lL++++++as +gd++qRla++f ++L+arl++++ +l k l +++ s     e+l+a++l+  ++ + k++h+
  Pahal.G00340.1 240 STLLIRCAQAVDTNNYLIAGELLNQIKQHASTTGDATQRLAQCFSKGLQARLMGTGRQLWKLLMAERLS---AMEVLKAYNLYMSACYFNKVAHI 331
                     579**********************************************************99999998...899******************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                         +I + ++g++r+Hi+D++i   +QW+ L + La+R+ ++pp+++iT++   +++    +  ee   rL+k+A+elg++f f++ v++++e+
  Pahal.G00340.1 332 FSALTIAQVMKGKRRLHIVDYGIHCAFQWAGLVRWLAKREgGPPPEVKITAMCCCQASsfPVQWSEEQWYRLSKYASELGLTFVFEA-VTTEWEK 425
                     ****************************************55667******877666666999999999******************.799**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     + +e+L+++ +E+++V+  ++l +l des   +s  +rd+vL+ +k+++P++++ +  + +  ++ Fl rf e l yysalfd+l++ +prese 
  Pahal.G00340.1 426 VCIESLNLDADEVVVVSDLFNLSTLKDESIFFDSpnPRDTVLSNIKKMRPNIFIQSILNFSQ-GSCFLSRFREMLFYYSALFDMLDVIVPRESES 519
                     *****************************97776669****************999999887.789***************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     r ++E+ ++gr + n +acega+ ++r e++++W+ r ++aG++++pl+  ++k  k  ++k++ +++ + ee ++l++gWk+r L++ S W
  Pahal.G00340.1 520 RLVLEQDIFGRCVLNGIACEGADLVQRPEKYRRWQLRNQRAGLRQLPLRPVVMKVLKDKVKKHHHKEFLLSEEGQWLLQGWKGRVLFAHSTW 611
                     ****************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.14213592IPR005202Transcription factor GRAS
PfamPF035141.4E-83240611IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MAATPEEFFA EGLMEPSPPS PSVFLDLTPV PDPNTANKGQ PSHDDLVLPY ISRMLMEDDI  60
DDKLLCQYSD HPALLQAQQP FTQILSSPST GTNMDDTGNK DTMDQVNDLL LISSGDESTL  120
SLALSDSEYV VGEFLKGMEV ANRLLPGDNS FIKDHQMSQI FIRSKRKHME EEVGRTSKIM  180
MMTKVPEETG IREMLDNMMM SGHDTLIRDM EKLRIAMDNK EEKKNREGCS KATRDMVDLS  240
TLLIRCAQAV DTNNYLIAGE LLNQIKQHAS TTGDATQRLA QCFSKGLQAR LMGTGRQLWK  300
LLMAERLSAM EVLKAYNLYM SACYFNKVAH IFSALTIAQV MKGKRRLHIV DYGIHCAFQW  360
AGLVRWLAKR EGGPPPEVKI TAMCCCQASS FPVQWSEEQW YRLSKYASEL GLTFVFEAVT  420
TEWEKVCIES LNLDADEVVV VSDLFNLSTL KDESIFFDSP NPRDTVLSNI KKMRPNIFIQ  480
SILNFSQGSC FLSRFREMLF YYSALFDMLD VIVPRESESR LVLEQDIFGR CVLNGIACEG  540
ADLVQRPEKY RRWQLRNQRA GLRQLPLRPV VMKVLKDKVK KHHHKEFLLS EEGQWLLQGW  600
KGRVLFAHST WVVEDGSSE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-282436118374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978028.20.0PREDICTED: scarecrow-like protein 9
TrEMBLK3YDL30.0K3YDL3_SETIT; Uncharacterized protein
STRINGSi012318m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-104GRAS family protein