PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 644aa    MW: 70217.6 Da    PI: 5.6821
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00339.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS294.33.1e-902646362374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      + L++cAeav+++d + +  lL+r++ ++sp+gd +qRla+yf+ +L+arla+++s+ly+++ +++ s    ++ l a +l   ++ +l + +l
  Pahal.G00339.1 264 HTMLIRCAEAVAADDRRGVADLLERIRRHSSPAGDGTQRLAHYFALGLEARLAGTGSRLYRSIMVRRGS---LADYLRACQLHMTACCFLPVIFL 355
                     578*************************************************************99999...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                         aI  av+g +++Hi+ +++++GlQWp  l+ L  R++gpp++R+Tg++sp +g   ++ +eetg+rL++ A+++gvpf+f+  +a + ed+
  Pahal.G00339.1 356 FSSDAICSAVAGRKKLHIVCYGLGHGLQWPDVLRRLGHRDGGPPEVRLTGIDSPLPGfrPAQLIEETGRRLNDSARRFGVPFRFRG-IAAKSEDV 449
                     ******************************************************9999999*************************.69999999 PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                        +L+++p+E+l+V + ++  +l+de v+ +s  + d+vLk++++++P v++++  +a+++++ Fl+rf e l+ ++alfd+l++ lpre+  r
  Pahal.G00339.1 450 LAGDLDIDPDEVLVVASTFHFRSLMDEGVAGRStnPMDTVLKTIREMRPAVFIHAIVNASYSAAFFLTRFREVLYRFTALFDMLDTVLPREDLRR 544
                     9**************************988776669*********************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      ++Er +l++ + nv+acega+r++r +++++W++r ++aG++++pl+  +++  +  +rk + + +++ e++++l+ gWk+r L+++S W+
  Pahal.G00339.1 545 LVLERDVLAQCAANVIACEGADRVQRPRSYKQWQARSRRAGLQQLPLDRGVVQMLRDKVRKEYHRCFEISEDQQWLLPGWKGRVLYALSTWT 636
                     ***************************************************************9***************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.101237616IPR005202Transcription factor GRAS
PfamPF035141.1E-87264636IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MEHNQPSSGC IFLDMPPASQ VDGGEDGDSV LPYISRMLME ENVVDKFLCQ YPDHPALLQA  60
QQPFTQILSD ARAAHQPCSS VELSAVQASA PAPYRSSYID APAAAAAPSV AQGNNTEDPA  120
PAFSLNVMAM ATDTVEPSSS LSAESSSSCC MDVVSMAFFK GMEEASKFLP GDGVPAGGGR  180
GQKKRLDGDD EAEAGAGRSS KQMAADGEES EEAAAREILD QLMLNGCEPS AADMQELRAA  240
VEMEKTPRGS SRGTSAAGQA VDLHTMLIRC AEAVAADDRR GVADLLERIR RHSSPAGDGT  300
QRLAHYFALG LEARLAGTGS RLYRSIMVRR GSLADYLRAC QLHMTACCFL PVIFLFSSDA  360
ICSAVAGRKK LHIVCYGLGH GLQWPDVLRR LGHRDGGPPE VRLTGIDSPL PGFRPAQLIE  420
ETGRRLNDSA RRFGVPFRFR GIAAKSEDVL AGDLDIDPDE VLVVASTFHF RSLMDEGVAG  480
RSTNPMDTVL KTIREMRPAV FIHAIVNASY SAAFFLTRFR EVLYRFTALF DMLDTVLPRE  540
DLRRLVLERD VLAQCAANVI ACEGADRVQR PRSYKQWQAR SRRAGLQQLP LDRGVVQMLR  600
DKVRKEYHRC FEISEDQQWL LPGWKGRVLY ALSTWTAGDD DLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-372676358374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978027.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3Y5U30.0K3Y5U3_SETIT; Uncharacterized protein
STRINGSi009582m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-117GRAS family protein