PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 338aa    MW: 36912.9 Da    PI: 7.1641
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00324.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.3e-52101391129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+ +yLkkkv  +k++l evi+evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk +
  Pahal.G00324.1  10 VPPGFRFHPTDEELLLYYLKKKVGFEKFDL-EVIREVDLNKIEPWELQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKATGRDKCI 103
                     69****************************.99**************963433332566************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  Pahal.G00324.1 104 RT-SYRKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 139
                     *9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-605161IPR003441NAC domain
PROSITE profilePS5100557.9110161IPR003441NAC domain
PfamPF023651.6E-2711138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MAAFSSSNGV PPGFRFHPTD EELLLYYLKK KVGFEKFDLE VIREVDLNKI EPWELQERCR  60
IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR  120
GRAPHGQKTD WIMHEYRLED ADDAQGGTSE DGWVVCRVFK KKCFFKIGGG EGSTSQGADA  180
GGHLAVSPPL GGHHDQARAA LASHYMHPHQ YYHHASSYYS QMQAPAPHAA YSHHVQVQDL  240
LTNHRPGDDA AGAGYDFSGL PVEHHPGGLD VGSSDGVAAD GAQLGEGRDQ ASGAAAEQWQ  300
AMDGFSNGGG AAVQQMAGAM SSGAQRGGEM DLWGYGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-551016217166NO APICAL MERISTEM PROTEIN
1ut4_B7e-551016217166NO APICAL MERISTEM PROTEIN
1ut7_A7e-551016217166NO APICAL MERISTEM PROTEIN
1ut7_B7e-551016217166NO APICAL MERISTEM PROTEIN
3swm_A1e-541016220169NAC domain-containing protein 19
3swm_B1e-541016220169NAC domain-containing protein 19
3swm_C1e-541016220169NAC domain-containing protein 19
3swm_D1e-541016220169NAC domain-containing protein 19
3swp_A1e-541016220169NAC domain-containing protein 19
3swp_B1e-541016220169NAC domain-containing protein 19
3swp_C1e-541016220169NAC domain-containing protein 19
3swp_D1e-541016220169NAC domain-containing protein 19
4dul_A7e-551016217166NAC domain-containing protein 19
4dul_B7e-551016217166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715420.0EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824150.10.0protein BEARSKIN1-like
SwissprotQ9SV871e-110BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A2S3I6V20.0A0A2S3I6V2_9POAL; Uncharacterized protein
STRINGSi012319m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-90NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]