PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00317.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 176aa    MW: 19889.9 Da    PI: 9.1265
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00317.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.22.9e-251159250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi+fs++gk+ye +
  Pahal.G00317.1 11 RIENPGHRQVTFCKRRMGLLKKANELSVLCDADIGVIVFSPHGKMYELA 59
                    8*********************************************965 PP

2K-box40.21.4e-1475144169
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskK 69 
                     y++++g+s  ++k +   qe+  L +eie Lq+ +R + Ge d++ +sl eL++Le++Le  +++iRs+K
  Pahal.G00317.1  75 YGERQGESSGKKKPQAIPQEVLALAREIELLQKGLRYMYGEnDINHMSLDELESLESNLEIWVQNIRSQK 144
                     67789999999*****************************978*************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554556.54E-28177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.889262IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-35261IPR002100Transcription factor, MADS-box
CDDcd002651.60E-36379No hitNo description
PRINTSPR004046.8E-26424IPR002100Transcription factor, MADS-box
PROSITE patternPS003500458IPR002100Transcription factor, MADS-box
PfamPF003192.0E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-262439IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-263960IPR002100Transcription factor, MADS-box
PfamPF014861.1E-1483144IPR002487Transcription factor, K-box
PROSITE profilePS512978.38988175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MMARGKVQMR RIENPGHRQV TFCKRRMGLL KKANELSVLC DADIGVIVFS PHGKMYELAT  60
NGNMQVLIER YKTAYGERQG ESSGKKKPQA IPQEVLALAR EIELLQKGLR YMYGENDINH  120
MSLDELESLE SNLEIWVQNI RSQKISEQNG ILNASGSVMV PQVPFQLNRG SNCYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-16277174MEF2C
5f28_B4e-16277174MEF2C
5f28_C4e-16277174MEF2C
5f28_D4e-16277174MEF2C
6byy_A4e-16277174MEF2 CHIMERA
6byy_B4e-16277174MEF2 CHIMERA
6byy_C4e-16277174MEF2 CHIMERA
6byy_D4e-16277174MEF2 CHIMERA
6bz1_A4e-16277174MEF2 CHIMERA
6bz1_B4e-16277174MEF2 CHIMERA
6bz1_C4e-16277174MEF2 CHIMERA
6bz1_D4e-16277174MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126122e-61CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823445.11e-111MADS-box transcription factor 26-like isoform X2
SwissprotA2YQK99e-59MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G89e-59MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A2T8ICF21e-110A0A2T8ICF2_9POAL; Uncharacterized protein
STRINGSi012632m2e-88(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.15e-46AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]