PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00246.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 202aa    MW: 22562.1 Da    PI: 4.892
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00246.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.47.4e-3371241128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGf+F P+deelvv++L++k++  +++  ++++++ +++++Pw+L+ k+ +  ++wyfFs++         ++r+t +gyW++   d+ v+s 
  Pahal.G00246.1   7 LPPGFHFFPSDEELVVHFLRHKASLLPCQP-DIVPTILLNHYDPWELNDKALQAGNQWYFFSHAT--------QSRVTPNGYWSSICADEMVKS- 91 
                     79*************************999.89**************966667789******975........5799***************99. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g ++glkktLvf  g+ ++g +t+W+mhey+l
  Pahal.G00246.1  92 SGCNIGLKKTLVFSIGEPSEGIETNWIMHEYHL 124
                     9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-434163IPR003441NAC domain
PROSITE profilePS5100538.9337165IPR003441NAC domain
PfamPF023655.8E-228124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGGASDLPPG FHFFPSDEEL VVHFLRHKAS LLPCQPDIVP TILLNHYDPW ELNDKALQAG  60
NQWYFFSHAT QSRVTPNGYW SSICADEMVK SSGCNIGLKK TLVFSIGEPS EGIETNWIMH  120
EYHLLDGRKV SSSSTSTSSS RKLHREKGHS NTESNNWVIC RVFDSTCGSQ ANFHEEGMEL  180
SCLDEVFLSL DDYDEVSLSN N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-35717017170NO APICAL MERISTEM PROTEIN
1ut4_B3e-35717017170NO APICAL MERISTEM PROTEIN
1ut7_A3e-35717017170NO APICAL MERISTEM PROTEIN
1ut7_B3e-35717017170NO APICAL MERISTEM PROTEIN
3swm_A3e-35717020173NAC domain-containing protein 19
3swm_B3e-35717020173NAC domain-containing protein 19
3swm_C3e-35717020173NAC domain-containing protein 19
3swm_D3e-35717020173NAC domain-containing protein 19
3swp_A3e-35717020173NAC domain-containing protein 19
3swp_B3e-35717020173NAC domain-containing protein 19
3swp_C3e-35717020173NAC domain-containing protein 19
3swp_D3e-35717020173NAC domain-containing protein 19
4dul_A3e-35717017170NAC domain-containing protein 19
4dul_B3e-35717017170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823281.11e-150NAC domain-containing protein 104-like isoform X1
SwissprotQ8GWK61e-61NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A2S3I7J81e-148A0A2S3I7J8_9POAL; Uncharacterized protein
STRINGPavir.J14631.1.p1e-137(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.19e-63xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]