PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 299aa    MW: 31674.5 Da    PI: 9.1617
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00118.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260104.68.5e-3378175299
          DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                     CaaC+++r++C+++C+lapyfpa++p +f+ v ++FG++n+l++l+++p+ + ++ ++++v e+++r+ dPv+G+vg i +l+ ql  +++el++
  Pahal.G00118.1  78 CAACRHKRQRCPPGCALAPYFPADDPDRFRSVLRVFGVKNLLRTLREVPRPRWDACVRTIVHESRMRLADPVRGCVGAIEDLEAQLVDTAVELEV 172
                     ********************************************************************************************998 PP

          DUF260  97 lke 99 
                     l++
  Pahal.G00118.1 173 LRR 175
                     875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.61976177IPR004883Lateral organ boundaries, LOB
PfamPF031959.1E-3278174IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MSAPAAAQGA PTWSPPSGCA IASESEPDSP SSDGTSSPPA PATGGRSSIA SSSTPPPAAR  60
ARAPATPGSG GGSPPPGCAA CRHKRQRCPP GCALAPYFPA DDPDRFRSVL RVFGVKNLLR  120
TLREVPRPRW DACVRTIVHE SRMRLADPVR GCVGAIEDLE AQLVDTAVEL EVLRRRQEAY  180
QQARRRGGLR LQPPNPRGRA DADAALPSGV TNLGVMQPQG SYGGATWPRA MTGLVATQPQ  240
LSAMAPQFYG TQPQTAMRRQ PTPGVTAMVH DGFGNAWAND DERGDPDDMR RRRRDEES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-23631712105LOB family transfactor Ramosa2.1
5ly0_B6e-23631712105LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436474.16e-46LOB domain-containing protein 22
TrEMBLA0A2S3I6F30.0A0A2S3I6F3_9POAL; Uncharacterized protein
STRINGPavir.J19063.1.p1e-111(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1968178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-23LOB domain-containing protein 11