PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F02573.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 388aa    MW: 39850 Da    PI: 10.0682
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F02573.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32252305255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pahal.F02573.2 252 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 305
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15249306IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-29250306IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-24252305IPR006447Myb domain, plants
PfamPF002495.4E-7253304IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEARAASAPD LSLHISLPSS AASPPPAPGR LGAAAGGGRG AQPAAGGDPW RRLNGSTAST  60
ELSLSPPPRQ EAAGDVLPWR LRPPAANNAA SSSTSAATAE AASLVPVTVP RLSLDAATEA  120
ARARPINGVP VYSSPRAAGH PFLGAGEYRQ GHPKVGLYNP YHASSWPSSL RSTTTSPAAA  180
PSASDPAAAF LSPSAYHRML SGTGRLHLHG VLADTFRGYG GHHQQQQQHF GSLASARYMP  240
KFPASRRGMR APRMRWTSSL HARFVHAVEL LGGHERATPK SVLELMDVKD LTLAHVKSHL  300
QMYRTVKSTD KPATSSGPVD GGGSGDDDLP DAGQAPSAGE DASPQPFTRR SASSEGAASH  360
AGGDVECSSA EDSDGGRARS GASSRSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-16253307357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-16253307357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-16253307357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-16253307357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9350031e-169EU935003.1 Zea mays cultivar B73 kanadi1 (kan1) mRNA, complete cds.
GenBankJX4699821e-169JX469982.1 Zea mays subsp. mays clone UT3342 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025820100.10.0probable transcription factor RL9 isoform X2
SwissprotQ0J2352e-72ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A2S3I3A80.0A0A2S3I3A8_9POAL; Uncharacterized protein
STRINGPavir.Fb00812.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-41G2-like family protein