PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F01993.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 284aa    MW: 30191.2 Da    PI: 5.695
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F01993.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.9e-311871255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    +rlrWt +LH+rFv av+qLGG+++AtPk++l++m v+gLtl+h+kSHLQkYRl
  Pahal.F01993.3 18 ARLRWTRQLHDRFVLAVAQLGGADRATPKSVLRAMAVPGLTLYHLKSHLQKYRL 71
                    7****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.2571474IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-311575IPR009057Homeodomain-like
SuperFamilySSF466891.06E-151774IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-221872IPR006447Myb domain, plants
PfamPF002495.9E-61970IPR001005SANT/Myb domain
PfamPF143796.8E-16136175IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MASSCGGGQQ QQGGEARARL RWTRQLHDRF VLAVAQLGGA DRATPKSVLR AMAVPGLTLY  60
HLKSHLQKYR LAVSRGFITT PPGEGSNDPW SSSSEGQPDE YDEDAAAEWR GAFAAADGGA  120
AGTKEAPCDS PRSMARMQRE VQRKLQEQVE VQRHLQLRIE AQGRYLQSVL RRAEEVLADH  180
SLGSPAAMAE LSELASAVES GCLSSSSSPS PSPPRRRSAD SCITSSSSEA ESQAGTGSKR  240
PCTCAAEQPV QGKRTFLQSH EAGEADADAE AEDGSSPEID LNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-181772156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-181772156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-181772156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-181772156Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9689754e-76EU968975.1 Zea mays clone 325336 MYR1 mRNA, complete cds.
GenBankKJ7268394e-76KJ726839.1 Zea mays clone pUT3379 G2-like transcription factor (GLK6) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822647.10.0myb family transcription factor PHL8-like
TrEMBLA0A2S3I2R70.0A0A2S3I2R7_9POAL; Uncharacterized protein
STRINGPavir.J03046.1.p1e-139(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.38e-43G2-like family protein