PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F01981.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 382aa    MW: 42882.2 Da    PI: 8.1173
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F01981.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-52161431128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     l+pGfrFhPtdeelv++yLk+k+++k++++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s+
  Pahal.F01981.1  16 LMPGFRFHPTDEELVSFYLKRKIQQKPISI-ELIRQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSVRPNRVTAAGFWKATGTDRPIYSS 109
                     689***************************.89***************9888999***************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkk+Lvfykgra +g ktdW+mhe+rl
  Pahal.F01981.1 110 eGTKCIGLKKSLVFYKGRAARGMKTDWMMHEFRL 143
                     56667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5715174IPR003441NAC domain
PROSITE profilePS5100557.116174IPR003441NAC domain
PfamPF023656.9E-2618143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEARNDINMD KSDEILMPGF RFHPTDEELV SFYLKRKIQQ KPISIELIRQ LDIYKYDPWD  60
LPKLASTGEK EWYFYCPRDR KYRNSVRPNR VTAAGFWKAT GTDRPIYSSE GTKCIGLKKS  120
LVFYKGRAAR GMKTDWMMHE FRLPSLNDPS LPKRPVDKTI PLNDSWTICR IFKKTSSMAQ  180
RALSHTWGPP LPGATEAEMF SAFQSVQASE FALESSSCSL QVAAPAPASQ FTSRHGLQGQ  240
QQQQNKVNNP SLDGSSCKLI NFNYSQSLEP QNFPITFPFE VQTSQKTTAA APMFFSTQPD  300
HLSGFVVDSS AEVNGGIGSR SQDPSTRKPG NGFSMNNSDW EAGGRINFPF DLGADSSEDW  360
RCNIPWESFL SPAAVQTELP H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-521617717168NO APICAL MERISTEM PROTEIN
1ut4_B2e-521617717168NO APICAL MERISTEM PROTEIN
1ut7_A2e-521617717168NO APICAL MERISTEM PROTEIN
1ut7_B2e-521617717168NO APICAL MERISTEM PROTEIN
4dul_A2e-521617717168NAC domain-containing protein 19
4dul_B2e-521617717168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822140.10.0protein FEZ-like
SwissprotQ9ZVH04e-99FEZ_ARATH; Protein FEZ
TrEMBLA0A2S3I2S60.0A0A2S3I2S6_9POAL; Uncharacterized protein
STRINGSi015514m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-101NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]