PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F00337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 658aa    MW: 71421.4 Da    PI: 4.3564
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F00337.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.97.9e-53221501129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv++yLk+kv g++l++ ++i+evd+yk+ePwdLp+  ++++++++wyfFs+ d+k+a+  r+nrat+ gyWk+tgkd+ev 
  Pahal.F00337.1  22 LAPGFRFHPTDEELVSYYLKRKVLGRPLKV-DAIAEVDLYKLEPWDLPArsRLRSRDSQWYFFSRLDRKHANRARTNRATSGGYWKTTGKDREVR 115
                     579***************************.99***************4357888999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + + + vg+kktLvf+ grapkge+t+Wvmheyrle
  Pahal.F00337.1 116 H-GPRIVGMKKTLVFHAGRAPKGERTNWVMHEYRLE 150
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6116170IPR003441NAC domain
PROSITE profilePS5100559.40522170IPR003441NAC domain
PfamPF023652.1E-2824149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MTHPSSSSSS APPPAAAEAT SLAPGFRFHP TDEELVSYYL KRKVLGRPLK VDAIAEVDLY  60
KLEPWDLPAR SRLRSRDSQW YFFSRLDRKH ANRARTNRAT SGGYWKTTGK DREVRHGPRI  120
VGMKKTLVFH AGRAPKGERT NWVMHEYRLE GEEAAGIPQD SFVVCRIFQK AGPGPQNGAQ  180
YGAPFVEEEW EEDDEDVGLL PVEGDAVVDH EVPPGPKEIP GALEKGYLQM SDLIQGLGDQ  240
NGNGTIGLPV SDTSNNSNHS EDVDGNSGDI LSDPNLGSNF LQYVEPGEQN SLMLNENMIS  300
NSNAGDFLNN FSPSDGFLEL KDFADAANLD YPLGNESTVW PSDGWAWKTP DSLETVNGAN  360
NDIPPLPDDQ TFQPDELEQL LQSIQEDSHL GSSVIDPPHS SITNSVMPED DSLMFYDAPF  420
DSTMCDDGFR QVNGILNSPA TNLSGIGMVD DGMPYYDAMD DNLFNDILGS IQQSAGSSHA  480
FNGPVLTQEV NNTMYTYSPT QKVLEPNFVV GASSSARLPE AGSQLNCVVL PDGQAKSSSI  540
GKRILDSISA PPAFASEFPA HLRKSLAPIS GARPNTFHVS AEVISIGSLA VASGPDKWSL  600
QKNQGMELLI TDFEPGTRIH CGCNTITTVL RGGFCLVFFS AIMLLVSYEV GMCIYGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-47171709168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0639170.0BT063917.1 Zea mays full-length cDNA clone ZM_BFc0120A04 mRNA, complete cds.
GenBankKJ7280190.0KJ728019.1 Zea mays clone pUT6155 NAC transcription factor (NAC12) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025820240.10.0NAC domain-containing protein 53-like
TrEMBLA0A2S3I4R10.0A0A2S3I4R1_9POAL; Uncharacterized protein
TrEMBLA0A2T7DAU20.0A0A2T7DAU2_9POAL; Uncharacterized protein
STRINGPavir.Fa00048.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.16e-82NAC domain containing protein 2