PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E04372.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family BES1
Protein Properties Length: 348aa    MW: 36424.8 Da    PI: 8.8231
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E04372.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822207.73.2e-64181601145
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     +g+gr+ptw+ErEnnkrRERrRRaiaaki+aGLRa+G+yklpk++DnneVlkALc+eAGwvve+DGttyrkgskp+e+++a+g+s s sp+ss+q
  Pahal.E04372.1  18 AGAGRMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPDGTTYRKGSKPQERMDAIGCSVSPSPCSSYQ 112
                     589******************************************************************************************** PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasa......asllpvlsvlsl 145
                              sp++sy+asp+sssfps +s+ +++ ++       + +lp+l++ s+
  Pahal.E04372.1 113 --------LSPRASYNASPTSSSFPSGASSPFLPPNEMangidgNPILPWLKTFSN 160
                     ........788888888888888888888777766555556666888888888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056877.3E-6319158IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MASGGGGGGG AGGALGVAGA GRMPTWRERE NNKRRERRRR AIAAKIFAGL RAHGGYKLPK  60
HCDNNEVLKA LCNEAGWVVE PDGTTYRKGS KPQERMDAIG CSVSPSPCSS YQLSPRASYN  120
ASPTSSSFPS GASSPFLPPN EMANGIDGNP ILPWLKTFSN GTPSKKHPLL PPLLIHGGSI  180
SAPVTPPLSS PSARTPRMKT DWDESAVQPP WHGANSPSIV NSTPPSPGRS MAPDPAWLAG  240
IQISSTSPNS PTFSLVSTNP FSVFKESIPV GNSSRMCTPG QSGTCSPAIP GMPRSSDVHM  300
MDVVSDEFAF GSSTNGPQQA AGLVRAWEGE RIHEDSGSDD LELTLKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A1e-222292372442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B1e-222292372442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C1e-222292372442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D1e-222292372442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay function in brassinosteroid signaling. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817932.10.0protein BZR1 homolog 2
SwissprotQ0JPT41e-166BZR2_ORYSJ; Protein BZR1 homolog 2
TrEMBLA0A2S3HYR90.0A0A2S3HYR9_9POAL; Uncharacterized protein
STRINGPavir.Ea00221.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136638112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.16e-89BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]