PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E02182.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ARF
Protein Properties Length: 576aa    MW: 63254.4 Da    PI: 7.9617
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E02182.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.23.6e-24143244199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++
  Pahal.E02182.2 143 FCKTLTASDTSTHGGFSVPRRAAEDCfppldySLQRP-SQELVAKDLHGTEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGED 234
                     99****************************9966654.569************************************************..3489 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     + l+++v+r+
  Pahal.E02182.2 235 GVLRLGVRRA 244
                     9899999986 PP

2Auxin_resp105.94.7e-35270349282
      Auxin_resp   2 ahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +a++t++vF+++YnPr s+seF+v+++k+++++++++svGmR +m++e++d+serr++G+++g +d++p  W++SkW+sL
  Pahal.E02182.2 270 TQAVATRTVFHICYNPRLSQSEFIVPYWKFMRSFNQPFSVGMRCRMRYEGDDASERRCTGIIIGSRDAEP-MWHGSKWKSL 349
                     6899******************************************************************.9*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-42136262IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.7E-39139246IPR015300DNA-binding pseudobarrel domain
CDDcd100175.05E-23141243No hitNo description
PROSITE profilePS5086313.338143245IPR003340B3 DNA binding domain
PfamPF023625.1E-22143244IPR003340B3 DNA binding domain
SMARTSM010197.3E-23143245IPR003340B3 DNA binding domain
PfamPF065073.8E-30270349IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MAGIDLNTVE GEEDEEEAEA EAMPAERAGG AVCLDLWHAC AGPVAPLPRK GSAVVYLPQG  60
HLEHIGGDAA PPAVPPHVFC RVVDVNLHAD GATDEVYARV SLLPEDEEAE RRARARARED  120
EDAARDGEGG GAMKPLARTP HMFCKTLTAS DTSTHGGFSV PRRAAEDCFP PLDYSLQRPS  180
QELVAKDLHG TEWKFRHIYR GQPRRHLLTT GWSAFVNKKK LVSGDAVLFL RGEDGVLRLG  240
VRRAAQLKNV NLIPALHNQC SNHRNLGNVT QAVATRTVFH ICYNPRLSQS EFIVPYWKFM  300
RSFNQPFSVG MRCRMRYEGD DASERRCTGI IIGSRDAEPM WHGSKWKSLV VRWDDDIECR  360
RPNRVSPWEI EVTGSVSGSQ SHLCAPNSKR LKPCLPQVNP DIVLPYGSVS SDFAGSARSH  420
KVLQGQEFLG LKTHDGIAIS ASQATEARNL QCSDEYSSSI DKSNNILGVP RFGVRSPTGS  480
PGFPYHCSGF GESQRFQKVL QGQEVFRPFR GALADVHIRT AGMYQPDGMH ASGAAYKWPT  540
PQGCDFRQPT KPVLLQASSP SSVLMFPQIS SKAKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1113137918361Auxin response factor 1
4ldy_B1e-1113137918361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0690050.0BT069005.1 Zea mays full-length cDNA clone ZM_BFb0119L19 mRNA, complete cds.
GenBankJX4285080.0JX428508.1 Zea mays subsp. mays clone pUT3106 ARF12 ARF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818787.10.0auxin response factor 2-like
SwissprotQ0JKI90.0ARFB_ORYSJ; Auxin response factor 2
TrEMBLA0A2S3HT280.0A0A2S3HT28_9POAL; Auxin response factor
STRINGPavir.Eb02716.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-152ARF family protein
Publications ? help Back to Top
  1. Khanday I,Yadav SR,Vijayraghavan U
    Rice LHS1/OsMADS1 controls floret meristem specification by coordinated regulation of transcription factors and hormone signaling pathways.
    Plant Physiol., 2013. 161(4): p. 1970-83
    [PMID:23449645]