PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E01558.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 200aa    MW: 23149 Da    PI: 8.6693
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E01558.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.31.7e-5461331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePw+L  k  + ++++ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v 
  Pahal.E01558.1   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDSEWYFFGPRDRKYPNGCRTNRATQAGYWKSTGKDRRVN 99 
                     79****************************.99**************84335566899************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
  Pahal.E01558.1 100 Y-QNRPIGMKKTLVYYKGRAPQGLRTNWVMHEYRI 133
                     9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-644157IPR003441NAC domain
PROSITE profilePS5100559.4416156IPR003441NAC domain
PfamPF023656.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAPADLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DSEWYFFGPR DRKYPNGCRT NRATQAGYWK STGKDRRVNY QNRPIGMKKT LVYYKGRAPQ  120
GLRTNWVMHE YRIEESECEN TMGIQDSYAL CRVFKKNVAF GEFHKQKQGE CSSSQAKEKQ  180
EQFTNVRDAG QSSGSSEHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-55615617165NO APICAL MERISTEM PROTEIN
1ut4_B2e-55615617165NO APICAL MERISTEM PROTEIN
1ut7_A2e-55615617165NO APICAL MERISTEM PROTEIN
1ut7_B2e-55615617165NO APICAL MERISTEM PROTEIN
4dul_A2e-55615617165NAC domain-containing protein 19
4dul_B2e-55615617165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375962e-86AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence.
GenBankAP0055642e-86AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence.
GenBankAP0149652e-86AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126172e-86CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803497.11e-150NAC domain-containing protein 45-like
SwissprotA4VCM01e-87NAC45_ARATH; NAC domain-containing protein 45
SwissprotQ9FFI59e-88NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A2T7EVK61e-149A0A2T7EVK6_9POAL; Uncharacterized protein
STRINGPavir.Bb02626.1.p1e-149(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-103NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]