PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E00976.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 290aa    MW: 30897.2 Da    PI: 6.6487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E00976.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.28.7e-29179232155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r++WtpeLH+rFveav++L G + A+Pk+i++lm+v+gLt+e+v+SHLQkYR+
  Pahal.E00976.2 179 KARMVWTPELHHRFVEAVAHL-GDKGAVPKAIVRLMNVEGLTRENVASHLQKYRI 232
                     68*******************.999*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.201176235IPR017930Myb domain
SuperFamilySSF466896.45E-19177236IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-29178236IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-24179232IPR006447Myb domain, plants
PfamPF002499.9E-10181231IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MRAPSDPLRS RGRSGPAPTD HRDTVRNPSL LGRARPATAE YVMLSPRGGR PQDATAPAPS  60
SSSSSLRHAD GMGDGAGASG RVLEWEDGLP EASELTPVSH PLITPALAAA FRINIAGGAF  120
PAAASPFDDS ALAHDSPTSH LSFHCAEEED VEDDEEGEWE AEDAASGSGA CRGGRAGKKA  180
RMVWTPELHH RFVEAVAHLG DKGAVPKAIV RLMNVEGLTR ENVASHLQKY RIYLKRTRSP  240
PTRQPPPPSF PTAYGSPFNP HPPPDASNQN GYCAFPSRHC EKLQRDQAD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-26179235157Transcription factor LUX
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0666597e-87AK066659.1 Oryza sativa Japonica Group cDNA clone:J013068K17, full insert sequence.
GenBankAP0032517e-87AP003251.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0446B05.
GenBankAP0149577e-87AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126097e-87CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025815041.10.0transcription factor PCL1-like
TrEMBLA0A2S3HQ400.0A0A2S3HQ40_9POAL; Uncharacterized protein
STRINGSi002016m1e-118(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.14e-25G2-like family protein