PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E00728.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 453aa    MW: 49960 Da    PI: 4.3986
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E00728.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.51.4e-4961331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd el ++yLk+k+ gkkl + e+i+ev++yk+ PwdLp k ++++++ ewyfF++rdkkya+g+r+nr+t  g+Wk+tgkd++++
  Pahal.E00728.6   6 LPPGFRFHPTDLELCSYYLKRKIMGKKLLV-EAISEVELYKYAPWDLPdKsCLQSRDMEWYFFCPRDKKYANGSRTNRSTPFGFWKSTGKDRTIV 99 
                     79*************************999.89**************96358888999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++ vg+kktL+f++g+ap+g +tdWvm eyr+
  Pahal.E00728.6 100 L-NTRIVGMKKTLIFHEGKAPRGDRTDWVMYEYRM 133
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-593156IPR003441NAC domain
PROSITE profilePS5100556.5786156IPR003441NAC domain
PfamPF023653.9E-257133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MAQTSLPPGF RFHPTDLELC SYYLKRKIMG KKLLVEAISE VELYKYAPWD LPDKSCLQSR  60
DMEWYFFCPR DKKYANGSRT NRSTPFGFWK STGKDRTIVL NTRIVGMKKT LIFHEGKAPR  120
GDRTDWVMYE YRMEDSELDV AGFSKDAYVL CKIFKKSGLG PKLGEQYGAT LNEEEWDNVN  180
TETAFPLMPC PSSEVVGATN EPPCQHTVAS TSSVVKEPHV LTVASADGLP FEFSTSSITA  240
IDELHVHTLK HNGSEMATAN CASGALDACD PTEFSIISLE EIDKWASLND SAHNDGGASE  300
KLASLPDISE AEAQALEMNS DYCYNELVRL VESGVSTANS LSPGYVNTEC LNPPMISGFG  360
AVDDYLEIND LFPPGETASL KLPAPESQFR QYPLEQWPYN DLNRPQYDNE GAPAASLAAC  420
DLLPPISCSM HDNISVDGNT CSTNLMWSDC SN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-50215711169Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0535681e-149HM053568.1 Setaria italica NAC transcription factor gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814465.10.0NAC domain-containing protein 68-like
RefseqXP_025814466.10.0NAC domain-containing protein 68-like
RefseqXP_025814467.10.0NAC domain-containing protein 68-like
RefseqXP_025814468.10.0NAC domain-containing protein 68-like
TrEMBLA0A2S3HPD40.0A0A2S3HPD4_9POAL; Uncharacterized protein
STRINGPavir.J18990.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.12e-80NAC domain containing protein 103