PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E00662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 260aa    MW: 26687 Da    PI: 7.8357
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E00662.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13.2e-4333131199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+ql+++la
  Pahal.E00662.1  33 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQQDLA 127
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++k 
  Pahal.E00662.1 128 RAKY 131
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.72932133IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-4333129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MASSVPAPSG SVITVASSSS SAAAAAVCGT GSPCAACKFL RRKCQPDCVF APYFPPDNPQ  60
KFVHVHRVFG ASNVTKLLNE LHPFQREDAV NSLAYEADMR LRDPVYGCVG VISILQHNLR  120
QLQQDLARAK YELSKYQAAA AAASASTGPN GPQAMAEFIG SAMPNGAHNF INIGHSAALG  180
SIGGSPAVFG QEQFANSQML SRSYDGEPIA RLGINGGYEF GYSTAMGGAG PVSGLGTLGI  240
SPFLKSGTAG GDEKPSAGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-53231361114LOB family transfactor Ramosa2.1
5ly0_B3e-53231361114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9406810.0AY940681.1 Zea mays ASYMMETRIC LEAVES2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817833.10.0LOB domain-containing protein 6
RefseqXP_025817835.10.0LOB domain-containing protein 6
SwissprotQ32SG31e-163LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A2S3HPE20.0A0A2S3HPE2_9POAL; Uncharacterized protein
STRINGSi002599m1e-170(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-59LBD family protein