PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E00343.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 271aa    MW: 29434.9 Da    PI: 7.3146
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E00343.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.63.8e-30117170155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Pahal.E00343.1 117 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 170
                     59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-31114175IPR009057Homeodomain-like
PROSITE profilePS5129410.648114173IPR017930Myb domain
SuperFamilySSF466892.87E-19115174IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23118170IPR006447Myb domain, plants
PfamPF002494.3E-8120169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGEEAVDDYD LHLLGGGDDE RVMEWETGLP GADELTPLSQ PLVPPGLAAA FRIPPEPGRT  60
LLDVHRASAA TVSRLRRASA GSGSFQPFLA QHQQQQHPAA AAAEAADSSA ATNSSKRPRL  120
VWTPQLHKRF VDVVAHLGIK NAVPKTIMQL MNVEGLTREN VASHLQKYRL YVKRMQGLSN  180
EGPSPSDHIF ASTPVPHSLV HEPQAQVPAP PMYHHSIPMP MGVAAGGMVP TNNSGAGYGY  240
GYGYGYHHQQ QQQEAYHHHH HHHHHRAGDK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A5e-34117173157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-94HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
GenBankKF7694441e-94KF769444.1 Triticum aestivum cultivar Chinese Spring LUX-B gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817497.10.0transcription factor PCL1
SwissprotQ94DH37e-93PCL1_ORYSJ; Transcription factor PCL1
TrEMBLA0A2S3HMQ40.0A0A2S3HMQ4_9POAL; Uncharacterized protein
STRINGSi002653m1e-118(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.12e-59G2-like family protein