PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D02874.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 326aa    MW: 34498.4 Da    PI: 9.2315
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D02874.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-2487130144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr++ +++k+CE+H+hrg+srsrk++e
  Pahal.D02874.1  87 DPEPGRCRRTDGKKWRCSREAHGDSKYCEKHIHRGKSRSRKPVE 130
                     79***************************************998 PP

2QLQ613.3e-211448236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                     FTa+Q+q+L++Q+l+yKy+a+++PvP++L+++++
  Pahal.D02874.1 14 LFTASQWQELEHQALIYKYMASGAPVPHDLVLPLR 48
                    5*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-91349IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1431449IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-151547IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.7587131IPR014977WRC domain
PfamPF088791.2E-1988130IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MMLSGHGGGG GRRLFTASQW QELEHQALIY KYMASGAPVP HDLVLPLRLA TGVDTAPSLA  60
FPPQTSPSLG YWGCYGAGAP FGRKAEDPEP GRCRRTDGKK WRCSREAHGD SKYCEKHIHR  120
GKSRSRKPVE AVASSATSPA AAGYRPSALS ISPPRAPDAA PGFGHHHHQQ PHHGASSARA  180
PVHQAAAGAP LQLHLDASLH AASPPPSYHR YAHAYYAPPP SLFPGGYGHS QSKELQDAEL  240
RRRHYLALGA DLSLDKPPAA GGGGGGQDSA AATEKPLRRF FDEWPREGGD ARPWTVGAED  300
ATQLSISIPA ASPADLAAAR YHNGE*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0400711e-164BT040071.1 Zea mays full-length cDNA clone ZM_BFc0063G19 mRNA, complete cds.
GenBankBT0415401e-164BT041540.1 Zea mays full-length cDNA clone ZM_BFc0173L15 mRNA, complete cds.
GenBankBT0553901e-164BT055390.1 Zea mays full-length cDNA clone ZM_BFb0108H20 mRNA, complete cds.
GenBankEF5158501e-164EF515850.1 Zea mays putative growth-regulating factor 11 (GRF11) mRNA, complete cds.
GenBankJX4699851e-164JX469985.1 Zea mays subsp. mays clone UT3345 GRF-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025813440.10.0growth-regulating factor 2-like
SwissprotQ6AWY71e-95GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLA0A2S3HKX00.0A0A2S3HKX0_9POAL; Uncharacterized protein
STRINGPavir.Da01847.1.p1e-177(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-40growth-regulating factor 5