PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D01587.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family TCP
Protein Properties Length: 168aa    MW: 17442.8 Da    PI: 7.9082
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D01587.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP100.72.6e-3159124873
             TCP   8 hskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                     + ++h+kv gR+RRvR++a +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++ 
  Pahal.D01587.1  59 SADRHAKVAGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEAP 124
                     68********************************************************77776333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-2659120IPR005333Transcription factor, TCP
PROSITE profilePS5136924.4759113IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MSSSSELVLY NLVPAPQTLN PPQPHAAAAV SGDLSISTAV APPPQEPLRV RARHPVGSSA  60
DRHAKVAGRG RRVRIPAMVA ARVFQLTREL GHRTDGETIE WLLRQAEPSI IAATGTGVTP  120
EEAPPAHPVA ATASLMPVPY YTALLMQPPP TADSASGSGI AAQENNN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975168.15e-93PREDICTED: transcription factor PCF1-like
SwissprotO238753e-56PCF1_ORYSJ; Transcription factor PCF1
TrEMBLK7TSC87e-81K7TSC8_MAIZE; TCP transcription factor
STRINGGRMZM2G096610_P012e-80(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.13e-31TCP family protein