PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D01475.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 533aa    MW: 57062 Da    PI: 6.7768
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D01475.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31120173255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Pahal.D01475.1 120 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 173
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-29116174IPR009057Homeodomain-like
PROSITE profilePS5129412.601116176IPR017930Myb domain
SuperFamilySSF466895.2E-14119174IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-22120175IPR006447Myb domain, plants
PfamPF002499.3E-9121172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MGEVKEKVVM EILQDGEKRS SENSVPPAVL DLNEGFSEGS HGGEIGEDAD DDNEEEEDDD  60
DEGGSTSEVA GAGRSSSNSS TTNHNSRSNN KDHDMNSSSK GEGDGERAPT VRQYNRSKLP  120
RLRWTPDLHM AFVHAVERLG GQERATPKLV LQMMNVRGLS IAHVKSHLQM YRSKKLDHES  180
GHERAAISSV FSPMDFHMRR GDHRLYDMFF QRAAGSSISS RLLHNGGLFG SRSAVSPEAS  240
RLYGLLQRRQ PTMQTFDFKN YSSLRNQEWT FSQHAATAGT INDHAPAKGL IHDMIFRKDG  300
KPTSHLFDVR DAIASNRTSS AAAGAADHGG RVGSSDWIGS SSRPLSRTMS ATASTGFALG  360
SLHLLPRGRA STGSNGYHPN GDANTTSSDP MVTREALGSR LEAHLEPKNP SKVIGEMCTG  420
TAAKRTKASM EENGGTPDLQ LSLSPNVGRD ADKQAKKRKI LSIALSEQEE VDSDKMLPLS  480
LSLSLRGGDS GGEGSGGDAG RLEAATGSSS SSKKAALGLS TLDLTMSIKA LE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-18121175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-18121175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-18121175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-18121175357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432231e-171AC243223.1 Panicum virgatum clone PV_ABa006-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812252.10.0uncharacterized protein LOC112889712
TrEMBLA0A2S3HIT30.0A0A2S3HIT3_9POAL; Uncharacterized protein
STRINGPavir.Db01175.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.18e-35G2-like family protein