PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D01403.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 345aa    MW: 38858.2 Da    PI: 6.9144
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D01403.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.59.1e-52101391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+ +yL+kkv+ ++++l +vi+e+d++k+ePwdL+   ++ +  +++wyfFs++dkky+tg+r+nrat +g+Wkatg+dk++
  Pahal.D01403.1  10 VPPGFRFHPTDEELLYYYLRKKVAYEPIDL-DVIREIDLNKLEPWDLKDrcRIGTgPQNDWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAI 103
                     69****************************.9***************943444442456************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +  + + +gl+ktLvfy grap+g+ktdW+mheyrl
  Pahal.D01403.1 104 FLGNARRIGLRKTLVFYIGRAPHGKKTDWIMHEYRL 139
                     **999*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-586159IPR003441NAC domain
PROSITE profilePS5100557.6410159IPR003441NAC domain
PfamPF023652.4E-2711139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MHPSGGPLSV PPGFRFHPTD EELLYYYLRK KVAYEPIDLD VIREIDLNKL EPWDLKDRCR  60
IGTGPQNDWY FFSHKDKKYP TGTRTNRATM AGFWKATGRD KAIFLGNARR IGLRKTLVFY  120
IGRAPHGKKT DWIMHEYRLD EENVEIQEDG WVVCRVFKKK NYQRALNQAE MAALDDDELQ  180
PFPVPVPGAL PTDHKHNPHL MQYDHQFPSF DPSMQLPQLM SADQPVQTLL PSQPGVPIAM  240
SSLDVECSQN LMKLTSNGSD GMLHSGGGGV DRFTGTTDWS ILDKLLASHQ NLDQLFQGKV  300
STASAPPMAP YQQQLMELGG SSSLQRLPLQ YLGGEAADLL RFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-51816115167NO APICAL MERISTEM PROTEIN
1ut4_B9e-51816115167NO APICAL MERISTEM PROTEIN
1ut7_A9e-51816115167NO APICAL MERISTEM PROTEIN
1ut7_B9e-51816115167NO APICAL MERISTEM PROTEIN
4dul_A9e-51816115167NAC domain-containing protein 19
4dul_B9e-51816115167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ8339650.0AJ833965.1 Zea mays partial mRNA for hypothetical protein (nac6 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812849.10.0NAC domain-containing protein 76-like
SwissprotQ5Z6B61e-120NAC76_ORYSJ; NAC domain-containing protein 76
TrEMBLA0A2S3HIY20.0A0A2S3HIY2_9POAL; Uncharacterized protein
STRINGPavir.J05053.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34613781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-109NAC family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]