PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D00662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CO-like
Protein Properties Length: 374aa    MW: 39384.1 Da    PI: 6.3397
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D00662.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.16.4e-075499342
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                     ++C+ +e  ++   C+ +   lC+ C   +H        H +vp+
  Pahal.D00662.1 54 VWMCEVCELAPAAVTCKADAAVLCAACDADIHDAnplarrHARVPV 99
                    689*****************************44677777888775 PP

2CCT69.68.2e-24295338144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k+a
  Pahal.D00662.1 295 REARLMRYREKRKSRRFEKTIRYASRKAYAETRPRIKGRFAKRA 338
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.39951IPR000315B-box-type zinc finger
SMARTSM003364.1E-135299IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3525299IPR000315B-box-type zinc finger
CDDcd000214.33E-75599No hitNo description
PROSITE profilePS5101716.876295337IPR010402CCT domain
PfamPF062031.4E-17295337IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MELHKYWGVG GRRCGGCEAA PAAVHCRSCP SGGAFLCTAC DARPGHARLG HERVWMCEVC  60
ELAPAAVTCK ADAAVLCAAC DADIHDANPL ARRHARVPVA PIGSEAAAAA VEAMLFGTGE  120
PAASEAEEPQ NAAAGQHQHH HQQHALNLNV EAKDMKLDYL FSDLDPYLSV EIPRFQHADS  180
VVPNGVGAGA GAAVELDFTC GIGVKPSSYS SYTATSLAHS GSSSEVGVVP EAFCGGGGGG  240
GGSFELDFTR PKPQAYMPYT ATPQSHSVSS VDVEAVPERG DMAAARPVPL VGESREARLM  300
RYREKRKSRR FEKTIRYASR KAYAETRPRI KGRFAKRADH DADADDAEAE AEAAVPSAAA  360
YVLDFGYGVV PSF*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278410.0KJ727841.1 Zea mays clone pUT5885 C2C2-CO-like transcription factor (COL13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965689.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLK7WBK70.0K7WBK7_MAIZE; C2C2-CO-like transcription factor
STRINGGRMZM2G038783_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.16e-22CONSTANS-like 5