PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D00594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 344aa    MW: 37209.1 Da    PI: 8.7853
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D00594.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-333791155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Pahal.D00594.1 37 KPRLRWTAELHDRFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 91
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-323492IPR009057Homeodomain-like
PROSITE profilePS5129412.4573494IPR017930Myb domain
SuperFamilySSF466897.35E-173693IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-243792IPR006447Myb domain, plants
PfamPF002492.0E-83989IPR001005SANT/Myb domain
PfamPF143794.0E-21131174IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MFPSSKKQPS TGAASSNDRP MCVQGDSGGL VLTTDPKPRL RWTAELHDRF VDAVAQLGGP  60
DKATPKTIMR VMGVKGLTLY HLKSHLQKFR LGKQHKEFGD HTAMEMQRNV ASSSSVMGRT  120
MNDRSGVNVN SEALRIKMEV QRRLHGELEV QKHLQMRVEA QGKYMQSIVE KAYQALGSSD  180
CATWPTGYRS LGNQAVLDIG GGSTSFSSLQ DLHFYGGSSH MDQLLQQMER PMDSFLTLGE  240
SFIGSSADKK GPSHCSSMAS GKSSMMWAGE EPQQAKSGAD QLQMGSSTTM EGGIDVMDPI  300
AGLYEGAMSG DSMSKGFEGS SSKLEMKSPP HQHAPVGSQR VRI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-183793157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-183793157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-183793157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-183793157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280540.0KJ728054.1 Zea mays clone pUT6200 G2-like transcription factor (GLK34) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025810576.10.0myb family transcription factor APL-like
SwissprotQ9SAK54e-81APL_ARATH; Myb family transcription factor APL
TrEMBLA0A2S3HH910.0A0A2S3HH91_9POAL; Uncharacterized protein
STRINGSi006865m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.22e-83G2-like family protein
Publications ? help Back to Top
  1. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  4. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]