PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D00077.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 390aa    MW: 42928.3 Da    PI: 9.3106
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D00077.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like73.23.8e-23156207355
         G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     r+ Wt eLHe+F++a+e L G + AtP +i++lm+vkgLt +h+ SHLQk+Rl
  Pahal.D00077.2 156 RVTWTVELHEKFLDAIEVL-GDKYATPERIRRLMNVKGLTWKHIGSHLQKHRL 207
                     99*****************.99******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011014.869191IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521726.04E-71396IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.0E-813118No hitNo description
PROSITE profilePS5129413.627151210IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-21153210IPR009057Homeodomain-like
SuperFamilySSF466893.4E-15155211IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-19156209IPR006447Myb domain, plants
PfamPF002492.4E-6156206IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MALDFVKSRA AIEEELDLVL AEVHLRNIAP GSLANSELLH HILNELQVPV ITMCAHHDEA  60
ALSEHVALGA CSHVLKPLDT ASLNTLKQKA LEHKSKKATP QGPIPNRTKS RMVSSSTERL  120
QEMLILEGNN LSNPGNSEFE VPEVEKAHGC SKKLGRVTWT VELHEKFLDA IEVLGDKYAT  180
PERIRRLMNV KGLTWKHIGS HLQKHRLRKQ NAKQGGQHQR NASTKLVSEL IGSGQTAATT  240
ESITPRVDAD IREAYPSRMW KQVKEEAALK TYMYTRTSGI SRDGTKSVWD EYQKGLQKEF  300
SASNKRWQQI GLSLSKCQLP VKNNVVVIDG GVSSEAPKAA GEIGYGASVE ISGSSSLSTS  360
LLIKLEITII LKLLANTTMW ETLICLKVP*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025813474.10.0two-component response regulator ARR2-like isoform X2
TrEMBLA0A2S3HGX10.0A0A2S3HGX1_9POAL; Uncharacterized protein
STRINGPavir.Db00207.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-20response regulator 2