PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D00055.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 473aa    MW: 51758.6 Da    PI: 6.5775
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D00055.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.4e-32267321155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k rlrWt eLHerFveav++L G+ekAtPk++l+lmkv+gLt++hvkSHLQkYRl
  Pahal.D00055.3 267 KSRLRWTLELHERFVEAVNKLEGPEKATPKAVLKLMKVEGLTIYHVKSHLQKYRL 321
                     68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.838264324IPR017930Myb domain
SuperFamilySSF466898.06E-17265321IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-30265322IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-24267322IPR006447Myb domain, plants
PfamPF002493.5E-9269320IPR001005SANT/Myb domain
PfamPF143793.9E-22357403IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MSSQSVAIGE QIIAPNQIVH ACTSTQTSVH KLFDAKLDHG LLIDDTLSST SQSSNIKTEL  60
IRTSSLSRSL SVNLQKRSPE SDLESPLSHI SHPKFSDPIL SNSSTFCTSL FSSSSKNTDP  120
CRQIGTLPFL PHPPKCEQQV SARQSSSSSL LLNGDTGNAL DEAGKSDDLK DFLTLSGDAS  180
DGSFHGENNT LAFDEQMEFQ FLSEQLGIAI TDNEESPHLD DIYGTPPQLS SLPVSSCSNQ  240
SKQNLGSPVK VQLSSSRSSS DSATTNKSRL RWTLELHERF VEAVNKLEGP EKATPKAVLK  300
LMKVEGLTIY HVKSHLQKYR LAKYLPEPKE DKKASSEDKK AQLGSSSSDS SKTKNLQVAE  360
ALRMQMDVQK QLHEQLEVQR QLQLRIEEHA RYLQKILEEQ QKAGNLSLKA PTKAQAESPE  420
TTSKERSESE GGTTSPRASK NRNPDVDAEC KSPVGSKRTK VQVDPEREAP CS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-25267324259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-25267324259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-25267324259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-25267324259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-25267324259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-25267324259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-25267324259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-25267324259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR1 and PHR2 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:26082401}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated under Pi starvation conditions. {ECO:0000269|PubMed:26082401}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1846681e-172KF184668.1 Saccharum hybrid cultivar R570 clone BAC 005I10 complete sequence.
GenBankKF1847071e-172KF184707.1 Saccharum hybrid cultivar R570 clone BAC 084G07 complete sequence.
GenBankKF1848331e-172KF184833.1 Saccharum hybrid cultivar R570 clone BAC 001I10 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812859.10.0protein PHOSPHATE STARVATION RESPONSE 3
RefseqXP_025812860.10.0protein PHOSPHATE STARVATION RESPONSE 3
RefseqXP_025812862.10.0protein PHOSPHATE STARVATION RESPONSE 3
RefseqXP_025812863.10.0protein PHOSPHATE STARVATION RESPONSE 3
SwissprotQ6YXZ41e-168PHR3_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 3
TrEMBLA0A2S3HGL40.0A0A2S3HGL4_9POAL; Uncharacterized protein
STRINGPavir.J27649.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-69G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]