PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C04533.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 389aa    MW: 41010.7 Da    PI: 9.1137
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C04533.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.6e-32244299156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv a+++LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Pahal.C04533.1 244 KARRCWSPELHRRFVAALQRLGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 299
                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.2E-17241302IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-29241302IPR009057Homeodomain-like
PROSITE profilePS5129413.312241301IPR017930Myb domain
TIGRFAMsTIGR015572.4E-26244299IPR006447Myb domain, plants
PfamPF002495.6E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MMARKEDHHH HHLRALAARA VTDSLRAAAP RSATAAERAA RFEDCVRSLE AEKAKMEVFR  60
RELPISVHLV ADVIEWLKEE LAQHRRPAPA PAPAPTPELF APVAAAPAAA KRKAAPEGGT  120
VKAEADANDK RSWMSSAQLW SCGSHDASST ATANGGAAAK PSRKVSDAFL PRSGLPTLGR  180
SPDDAAEKPA ALPVPDLTLS SPAIDAACPA APSATSSAVT DGGAAAQRLR QRQQQQQQQA  240
QQRKARRCWS PELHRRFVAA LQRLGGAQVA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT  300
RRASSSDGCD LQVSAAAACP WPAPEQQYTT SQHSTSQSGS PQGPLQLTVS SRAMSATAGD  360
SCDGDEAEGG GSESYGFGAQ HGTKASSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-13244297154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-13244297154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-13244297154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-13244297154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025809801.10.0transcription factor NIGTH1-like
TrEMBLA0A2S3HF010.0A0A2S3HF01_9POAL; Uncharacterized protein
STRINGPavir.J13382.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55823353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-30G2-like family protein