PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C04509.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 417aa    MW: 44815 Da    PI: 7.5997
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C04509.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-3198151255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pahal.C04509.1  98 PRMRWTTALHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 151
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-1596151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-2896151IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-2398151IPR006447Myb domain, plants
PfamPF002493.5E-799150IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MSIRTSRATT MATPDLSLHI SPPSPPEAAG EMQAVEPRLL LGLELDTAAA KTDDAAAQRH  60
GGLQAQQQRL LHQPSQTAHG FKKSSGGGGG RRRSARAPRM RWTTALHAHF VHAVELLGGH  120
ERATPKSVLE LMNVKDLTLA HVKSHLQMYR TVKGTDRSCV AGLGQQARDM AFLRRGAGEV  180
DGFDVFNSSR SVNTTTTFNN YTNTARRSWS PSGEQQQRLD HQEAAAAACA WIHAHQLLQS  240
CGSDELTTLQ PPPCRLRPAA ADRLLMTTTT TEQSHAQQQG SKVGEQDHHG QGAVAAHHLA  300
DEAREKLPSQ PPPHDHHHAG SGLFQRPSPT NNTSSSGDTV SSPEWLQQRH YCSDGGGMSV  360
GMAAGLLPAP PPPSLEMSLG RQGWQMEQHA GVGVEFEFES SPPAPAPNEL TMLKCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-1699153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-1699153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-1699153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-1699153357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9684681e-83EU968468.1 Zea mays clone 321144 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805465.10.0uncharacterized protein LOC112884302
TrEMBLA0A2S3HF180.0A0A2S3HF18_9POAL; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.23e-36G2-like family protein