PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C04463.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 696aa    MW: 76291 Da    PI: 5.1825
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C04463.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS333.92.9e-1023396711334
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+av+++d + a++lL++++++asp+gd++qRla++f+e+L+arla+++s +y++l +++ts    ++ l+a++l+  +  + k+ +
  Pahal.C04463.1 339 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVDILQAYQLYMAAICFKKVVF 430
                     6789************************************************************999998...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +  Nq+I++a  g++++Hi+D++i +G+QWp++l+ +a+R++gpp++RiTg++ p++g   ++++eetg+rL+k+A+e+gvpf+++v++a+++e+
  Pahal.C04463.1 431 IFSNQTIYNASLGKKKIHIVDYGIHYGFQWPCFLRRIACREGGPPEVRITGIDLPQPGfrPTQRIEETGRRLSKYAQEFGVPFKYQVIAASKMET 525
                     *********************************************************9************************************* PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++ e+L+++p+E+l+Vn+++q ++l+desv +es+rd  L+ +++++P+ +++   + + +++ F++rf eal yysalfd l+++ pr+s++r+
  Pahal.C04463.1 526 IRAEDLNLDPEEVLIVNCIYQFKNLMDESVLIESPRDVALNNIRKMRPHAFIHGIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSNQRM 620
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                      +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aG+k++pl+ +++
  Pahal.C04463.1 621 LIEQNIFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKQLPLNPNIV 671
                     **********************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.32313691IPR005202Transcription factor GRAS
PfamPF035149.9E-100339671IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MGSSYDPSPS PGAVADDLAF YLSDLGPASP SAYLDLPPTP QHEKPQQPQH AQPDGGAAAS  60
PEDMVLPFIS RMLMEEDIDD KFFYEYPDHP ALLQAQQPFL DILSDDASSS PSAARSGASV  120
THPSTSSASS DAAANAPLTP AAVDSYAQFN GFDLDPAAFF SGGANSDLMS SAFLKGMEEA  180
NKFLPSQDKL VIDLDPPDDA KRFLLPAENK LAASGFNGTA PAAAVAVKVE EAVVPWPDAV  240
PGGGGGGRGR KNRFDDDDED LEMDRRSSKQ SALEGDGDDR DVFDKYMITS HEMCVEQMEK  300
LRIAMQEEAA KKEAAAGGGN GKSKAKGGGR RGGREVVDLR TLLIHCAQAV ATDDRRSATE  360
LLKQIKQHAS PQGDATQRLA HCFAEGLQAR LAGTGSMVYQ SLMAKRTSAV DILQAYQLYM  420
AAICFKKVVF IFSNQTIYNA SLGKKKIHIV DYGIHYGFQW PCFLRRIACR EGGPPEVRIT  480
GIDLPQPGFR PTQRIEETGR RLSKYAQEFG VPFKYQVIAA SKMETIRAED LNLDPEEVLI  540
VNCIYQFKNL MDESVLIESP RDVALNNIRK MRPHAFIHGI VNGSFSAPFF VTRFREALFY  600
YSALFDVLDT TTPRDSNQRM LIEQNIFGRA ALNVIACEGT DRVERPETYK QWQVRNQRAG  660
LKQLPLNPNI VQGWKGRILY AISTWVANDD AVSYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-413436678329GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
TrEMBLA0A096SPI30.0A0A096SPI3_MAIZE; Uncharacterized protein
STRINGGRMZM2G159475_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-143GRAS family protein