PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C04462.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 696aa    MW: 76877.8 Da    PI: 5.561
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C04462.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS356.83.2e-1093126841373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvse.lykalppsetseknsseelaalklfsevsPilkfs 94 
                     l++lLl+cA+av+++d + a +lL++++ +asp+gd++qRla++f+e+L+arla+++s+ +y++l +++ts   +++ l+a++l+  +  + k +
  Pahal.C04462.1 312 LRTLLLHCAQAVATDDRRSAIELLKQIKRHASPQGDATQRLAHCFAEGLQARLAGTGSRmVYQSLMAKRTS---VVDILQAYQLYMAAICFKKAA 403
                     6789***************************************************6665157777777776...********************* PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                     +l  Nq+I++a  g++++Hi+D++i +G+QWp++l+ +a+R++gpp++RiTg++ p++g   +++ eetg+rL+k+++e+gvpf+++v++a+r+e
  Pahal.C04462.1 404 FLFSNQTIYDASLGKKKIHIVDYGIHYGFQWPCFLRRIACREGGPPEVRITGIDLPQPGfrPTQRAEETGRRLSKYCQEFGVPFRYQVMAASRME 498
                     **********************************************************9*9****************************99**** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     +++ e+L+++p+E+l+Vn+++q ++l+desv +es+rd  L+ +++++P+ +v+   + + +++ F++rf eal yysalfd l+++ pr+s++r
  Pahal.C04462.1 499 TIRAEDLNLDPEEVLIVNCIYQFQNLMDESVLIESPRDVALNNIRKMRPHAFVHGVVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSSQR 593
                     *********************************************************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     + +E+ ++gr++ n++aceg++r+er et+++W+ r ++aG+k++pl+ ++++ ++  ++ ++ + + v+ ++++l++gWk+r L+++S W
  Pahal.C04462.1 594 MLIEQNIFGRAALNAIACEGTDRVERPETYRQWQVRNQRAGLKQLPLNPNIVQVVRDKVKGCYHKDFVVDIDHHWLLQGWKGRILYAISTW 684
                     ***************************************************************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.798286665IPR005202Transcription factor GRAS
PfamPF035141.1E-106312684IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MASSYDPSLY LSDLGPAYVD LPPTPQQPQC PQPSGGAAAW PEDMVLPFIS RMLMEEDIDD  60
KFFYEYPDHP ALLQAQQPFL DILSDDASSS PSAARSGASV THPSTATSSS DAADALLTPA  120
AVDSYAQFNA FDLDPAAFFS GGANSDLMSS AFLKGMEEAN KFLPSQDKLV IDLDPPDDAK  180
SFVRPAENKL AASGFKFNGA APAAAVAVKV EEAVVSASGG GVGGRGRKNR FDDDEDNLEM  240
DRRSSKQSAL QGDGDDRDVL DKQYMITSHE MCVAVEQMEK LRIPMQEEGG GNGKANAKGG  300
GGRRGGREVV DLRTLLLHCA QAVATDDRRS AIELLKQIKR HASPQGDATQ RLAHCFAEGL  360
QARLAGTGSR MVYQSLMAKR TSVVDILQAY QLYMAAICFK KAAFLFSNQT IYDASLGKKK  420
IHIVDYGIHY GFQWPCFLRR IACREGGPPE VRITGIDLPQ PGFRPTQRAE ETGRRLSKYC  480
QEFGVPFRYQ VMAASRMETI RAEDLNLDPE EVLIVNCIYQ FQNLMDESVL IESPRDVALN  540
NIRKMRPHAF VHGVVNGSFS APFFVTRFRE ALFYYSALFD VLDTTTPRDS SQRMLIEQNI  600
FGRAALNAIA CEGTDRVERP ETYRQWQVRN QRAGLKQLPL NPNIVQVVRD KVKGCYHKDF  660
VVDIDHHWLL QGWKGRILYA ISTWVANDDD AGSYV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-443166848374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
TrEMBLA0A096SPI30.0A0A096SPI3_MAIZE; Uncharacterized protein
STRINGGRMZM2G159475_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-154GRAS family protein