PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C03706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 208aa    MW: 21722.9 Da    PI: 6.613
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C03706.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.52.7e-4461051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+C+kdC++ap fpa++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la
  Pahal.C03706.1   6 PCASCKLLRRRCTKDCIFAPFFPADDPHKFAIVHKVFGASNVSKMLQELPVQQRGDAVSSLVYEANARMRDPVYGCVGAISFLQNQVSQLQMQLA 100
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Pahal.C03706.1 101 VAQAE 105
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4265106IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGGGSPCASC KLLRRRCTKD CIFAPFFPAD DPHKFAIVHK VFGASNVSKM LQELPVQQRG  60
DAVSSLVYEA NARMRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEILCIQ MQQRRDGGGG  120
GPDDVDAVVP PSSLVAAGGG GAGDHHHHVM AAAMQQHQAA MVAPDDVDAF LMQNAGAGAI  180
IPPQLMGYGA APAGAMGEPL KRESLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4721077112LOB family transfactor Ramosa2.1
5ly0_B2e-4721077112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963862.11e-127LOB domain-containing protein 12
SwissprotQ8LBW32e-69LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2S3HDD81e-149A0A2S3HDD8_9POAL; Uncharacterized protein
TrEMBLA0A2T7EFA01e-149A0A2T7EFA0_9POAL; Uncharacterized protein
STRINGSi024229m1e-126(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-71LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]