PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C03301.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 190aa    MW: 20285.9 Da    PI: 6.4936
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C03301.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601155e-36191191101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk +rr+C++dC+lapyfpa++p+++a+v+++FGasnv ++l++lp +er +a++ +v eA+ r++dPvyG++g++ +lq +++ ++ ela
  Pahal.C03301.1  19 RCAACKNQRRRCSQDCILAPYFPASDPQRYACVQRVFGASNVARMLQNLPIHERGKAADMMVVEAHRRVQDPVYGCAGIVGRLQGEIRAVQCELA 113
                     6********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++++++
  Pahal.C03301.1 114 RTQAQI 119
                     *99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4918119IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-3519116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MSTSSNTEAA AGASPGIRRC AACKNQRRRC SQDCILAPYF PASDPQRYAC VQRVFGASNV  60
ARMLQNLPIH ERGKAADMMV VEAHRRVQDP VYGCAGIVGR LQGEIRAVQC ELARTQAQIA  120
VHAAAAARAR SPVGAAQLNA PAQAALTQQQ QEQGDALAMQ QDPFHGLDPL LVDDYGVDVN  180
LVDDEMNTD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-29101231115LOB family transfactor Ramosa2.1
5ly0_B3e-29101231115LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025806770.11e-135LOB domain-containing protein 24-like
SwissprotP594674e-39LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594683e-39LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A2S3HD561e-134A0A2S3HD56_9POAL; Uncharacterized protein
STRINGPavir.J09684.1.p8e-91(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-37LBD family protein