PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C03016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 267aa    MW: 27198.4 Da    PI: 7.3269
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C03016.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.67.4e-25591031055
         G2-like  10 LHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Pahal.C03016.1  59 LHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 103
                     9***********.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015571.1E-1959103IPR006447Myb domain, plants
SuperFamilySSF466898.06E-1459107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-2459108IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MREEEEPSWF ARCEEQLPRP DELMPLSQTL ITPDLAVAFD IHSHGGGGGA GGGAGGGGLH  60
KRFVDAVAHL GIKNAVPKTI MQLMSVDGLT RENVASHLQK YRLYLKRMQG LGGGGGGGGG  120
GGGGAGGSHS SGSGTDAATE HLFATGPVPF LPPGHRAPAA AAADPYPPFA PMGHHHHHHH  180
APQIGHFHHP AARPLGHYGP AGAGFDHGFL SRAVGAGAPP VGPPGMHHHR MMAPASFADD  240
MDLGSRGGGG ASGRRELTLF PTSGDH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-25591061057Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865881e-130BT086588.1 Zea mays full-length cDNA clone ZM_BFc0188H07 mRNA, complete cds.
GenBankJX4699871e-130JX469987.1 Zea mays subsp. mays clone UT3347 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310197.11e-106uncharacterized protein LOC107548110
SwissprotO222102e-35MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A3L6RE091e-111A0A3L6RE09_PANMI; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G471600_P011e-105(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.11e-36G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]