PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C02549.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 413aa    MW: 45914.3 Da    PI: 6.7595
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C02549.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.2e-344498155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+WtpeLH+rFv+av+qLGG+ekAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Pahal.C02549.2 44 KPRLKWTPELHQRFVDAVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRL 98
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.38741101IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-324299IPR009057Homeodomain-like
SuperFamilySSF466898.6E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-234499IPR006447Myb domain, plants
PfamPF002497.7E-104697IPR001005SANT/Myb domain
PfamPF143792.8E-22145192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MYHQHQGPSE LFTTRTSFPM EQHLFLRGGN AQGDSGLVLS TDAKPRLKWT PELHQRFVDA  60
VNQLGGAEKA TPKTVMRLMG IPGLTLYHLK SHLQKYRLSK NLQAQANVST SKNAIGCATI  120
ADRMPGTSAP TMSSTNVIPQ AEKTIQIGEA LQMQIEVQRQ LNEQLEVQRH LQLRIEAQGK  180
YLQAVLEQAQ ETLGKQNLGP ANLEDAKIKI SELVSQVSNE CFSDAITDIK ESSSVHRLGP  240
KQIRFVESST SNYLTAAEGF IKEHRLQHHG VPKAYDDSSL FCRKGSHEHE NQIALNRSLS  300
ECRMAHLQNE KGYNKAEFGY ESDTEMAPEY ITPQKNGGGS TTSSASGSKG DAEKTYLEEP  360
NCTRQAVEYP RESKLLDFEH SCPGKTLDLN THNVDDADQA YRHFDLNGFS WS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2043100158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2043100158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-2044100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2044100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2044100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2044100157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2043100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2043100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2043100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2043100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2043100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2043100158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805060.10.0myb-related protein 2-like
RefseqXP_025805061.10.0myb-related protein 2-like
TrEMBLA0A2S3HBB60.0A0A2S3HBB6_9POAL; Uncharacterized protein
STRINGPavir.J02359.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.32e-95G2-like family protein