PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C02517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 266aa    MW: 29360.1 Da    PI: 7.7297
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C02517.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-324599155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    k+rlrWt++LH+rFv+a++qLGG+++AtPk +l +m+v+g+t++hvkSHLQkYRl
  Pahal.C02517.1 45 KQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 99
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.74242102IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-3143100IPR009057Homeodomain-like
SuperFamilySSF466899.85E-174499IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-2545100IPR006447Myb domain, plants
PfamPF002492.7E-74798IPR001005SANT/Myb domain
PfamPF143798.3E-24132177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MMYHAKNFSV PFAPQRAQNN EHASNIGAIS GANISNPANP VGSGKQRLRW TSDLHNRFVD  60
AIAQLGGPDR ATPKGVLTVM GVPGITIYHV KSHLQKYRLA KYIPESPAEG SKDEKKDSGD  120
SLSNTDSAPG LQINEALKMQ MEVQKRLHEQ LEVQRQLQLR IEAQGRYLQM IIEEQQKLGG  180
SIKASDDQKL SHSPPSLDEY PESTQPSPKK PRVDALSPDS KRDTTQAEFE PHLIGPWDQE  240
ICRKNLCGVA FPVEEFKADP GMSKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9752610.0EU975261.1 Zea mays clone 485946 MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025809946.10.0myb family transcription factor PHL7-like
RefseqXP_025809947.10.0myb family transcription factor PHL7-like
RefseqXP_025809948.10.0myb family transcription factor PHL7-like
SwissprotQ9SJW06e-73PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A2T8KJ350.0A0A2T8KJ35_9POAL; Uncharacterized protein
STRINGPavir.J05174.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79133343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.18e-60G2-like family protein