PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C02491.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 250aa    MW: 26966.1 Da    PI: 5.9047
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C02491.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.8e-1078121851
                     HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                     rr   NReA r++R++Kka  + Lee+vk+L a N++L  +l+ 
  Pahal.C02491.1  78 RRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRLQD 121
                     67778*********************************977654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-966138IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-1569139No hitNo description
PfamPF077161.4E-1373127IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.96773139IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.19E-876122No hitNo description
CDDcd146865.29E-1378129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MDDGADLPCQ LLFSHPEVPG SFDELFNSAT TTCTHTHSCN PPGPSGPMHT HTCLHTHTQV  60
FAGGAEDDDA REDPAKPRRP LGNREAVRKY REKKKAHAAF LEEEVKKLRA ANQQLLRRLQ  120
DHAALEAEVV RLRSLLLDVR GKIDAEVSAS PFQKPCSVGS VVSADPAPCF NGNSEVAGAW  180
EESFVPSAAD CRIDEGGGVS REIDVPEGLH HSMDVVANFV SGFCSKEQGM ISGSFNGVRY  240
YSAVCSHLL*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142351.11e-120putative bZIP transcription factor superfamily protein
SwissprotQ8GTS23e-53BZP23_ARATH; Basic leucine zipper 23
TrEMBLB4G1L81e-120B4G1L8_MAIZE; Uncharacterized protein
STRINGGRMZM2G175870_P011e-120(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.16e-22bZIP family protein