PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C02324.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ARF
Protein Properties Length: 585aa    MW: 64521.4 Da    PI: 7.4451
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C02324.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.36.9e-2433134199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++p++ ae++       ++ +  s++l+ +d++g +W++++iyr++++r++lt+GW++F + ++L +gD v+F   + +
  Pahal.C02324.2  33 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyeQLRP--SQELVAKDLHGMKWRFRHIYRGQPRRHLLTTGWSSFINKKKLVSGDAVLFL--RGN 123
                     99****************************9866664..459************************************************..448 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+++v+r+
  Pahal.C02324.2 124 DGELRLGVRRA 134
                     9999****996 PP

2Auxin_resp100.13e-33159240183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     +a++++++s+F++++nPr+++seF+v++ k++k+l++++s+GmRfk+   +ed+++r+  G+++g++++d++rWp+SkWr+L+
  Pahal.C02324.2 159 VASSLENRSIFHICFNPRTGASEFIVPYCKFLKSLNCPLSIGMRFKVGCKNEDANQRS-CGLISGINEVDSIRWPGSKWRCLQ 240
                     578899**************************************************99.8**********************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.05E-4423171IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-3830136IPR015300DNA-binding pseudobarrel domain
CDDcd100178.66E-2231133No hitNo description
PfamPF023627.3E-2233134IPR003340B3 DNA binding domain
SMARTSM010192.0E-2333135IPR003340B3 DNA binding domain
PROSITE profilePS5086313.11233135IPR003340B3 DNA binding domain
PfamPF065071.7E-27160240IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MFDRNIHDGE TEEKNCEMED GDGEKKPWTS HMFCKTLTAS DTSTHGGFSV PRRAAEDCFP  60
PLDYEQLRPS QELVAKDLHG MKWRFRHIYR GQPRRHLLTT GWSSFINKKK LVSGDAVLFL  120
RGNDGELRLG VRRAVQLKNE ALLEAVSSTD SKLRTLSAVA SSLENRSIFH ICFNPRTGAS  180
EFIVPYCKFL KSLNCPLSIG MRFKVGCKNE DANQRSCGLI SGINEVDSIR WPGSKWRCLQ  240
VKWDGDTKCN HQNRVSPWEI ERVGSSISVP HCLSSSVSKR TKLCFPQGDL DAPILDGNGR  300
PDSMETECFH WVLQGQELVR SRAQGVACSH SSDTPKCQSS YERRFSADVW NCKMNDAMSG  360
LRHRNATGFA YQPLVFGESF RFSEVLQGQE MSRAVPSFPG AAFGARAQNG RIGSFDYVQR  420
SAATQGYPLQ QFNPPATEAH SPSSVLMVNQ TTALQPELEG MANLGEANGS RYAPIATQRE  480
AETWPSAQQQ RARENGSELF DATEASAPAA VTKPGLADRG VRQSSCRLFG FSLTDEILGA  540
EEDGAKENYE AAQQTPRVLD LFGHGQSTPS ALPLHALCAA PLGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A4e-7729265120357Auxin response factor 1
4ldy_B4e-7729265120357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by auxin under light condition. {ECO:0000269|PubMed:17408882}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025807097.10.0auxin response factor 14-like isoform X2
SwissprotQ0DGS10.0ARFN_ORYSJ; Auxin response factor 14
TrEMBLA0A2S3HAF90.0A0A2S3HAF9_9POAL; Auxin response factor
STRINGSi021589m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-121ARF family protein
Publications ? help Back to Top
  1. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]