PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C01957.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ARF
Protein Properties Length: 729aa    MW: 79471 Da    PI: 7.4986
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C01957.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.91.1e-24159260199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++
  Pahal.C01957.3 159 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyS-QQRPSQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDD 250
                     99****************************963.3445679************************************************..3489 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+++v+r+
  Pahal.C01957.3 251 GELRLGVRRA 260
                     999***9996 PP

2Auxin_resp109.82.9e-36286365282
      Auxin_resp   2 ahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     aha++tksvF+++YnPr s+seF+++++k++k++++++s+G Rfkm++e++d+ err++G+++g+ d+dp  W++SkW++L
  Pahal.C01957.3 286 AHAVATKSVFHIYYNPRLSQSEFIIPYSKFMKSFSQPFSAGLRFKMRYESDDATERRYTGIIAGIGDADP-MWRGSKWKCL 365
                     89********************************************************************.9********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-43150274IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.9E-41152262IPR015300DNA-binding pseudobarrel domain
CDDcd100175.56E-23157259No hitNo description
PROSITE profilePS5086313.493159261IPR003340B3 DNA binding domain
SMARTSM010195.3E-23159261IPR003340B3 DNA binding domain
PfamPF023621.3E-22159260IPR003340B3 DNA binding domain
PfamPF065071.1E-30286365IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
MTGIDLNDTV EEDEAEAEAG NSCSQQSRSS SAATGTPPPP GPGAAVCLEL WHACAGPVAP  60
LPRKGSVVVY LPQGHLEHLG DAAAAAGGGT VPPHVFCRVV DLTLHADAST DEVYAQLALV  120
AENEEVARRL RGGSEDGSGG DGEDGDTVRQ RFSRMPHMFC KTLTASDTST HGGFSVPRRA  180
AEDCFPPLDY SQQRPSQELV AKDLHGTEWR FRHIYRGQPR RHLLTTGWSA FVNKKKLVSG  240
DAVLFLRGDD GELRLGVRRA AQLKNGSAFP ALYNQCSNLG SLANIAHAVA TKSVFHIYYN  300
PRLSQSEFII PYSKFMKSFS QPFSAGLRFK MRYESDDATE RRYTGIIAGI GDADPMWRGS  360
KWKCLMVRWD DDVDFRRPNR ISPWEIELTS SVSGSHLSAP NAKRLKPCLP HVNPDYLVPN  420
GSGRPDFAES AQFHKVLQGQ ELLGYRTRDN DAIATSQPCE ARNMHYIDER SCSNDASNNI  480
PGVPRHGART PLGNPGFPYH CSGFGESQRF QKVLQGQEVF RPYRGTLADA CLRNNAFHQQ  540
DGSHAPSVAN KWHTQLHGCA FRGSPAPMNP SQSSSPPSVL IFQQGNSKLS QFEFGHGPLD  600
KNVDGRPAML GHAGGIGGTE QTLMLQPHHV SEEVGNRHAI VEKFHSVGKD GTDNRDVNTN  660
SCKIFGISLA EKVPSSKQKE CGDANYPSPF LSLKQQVPKS LGNSCATVHE QRPVVGRVID  720
LSTMDMMI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1124539518361Auxin response factor 1
4ldw_A1e-1124539518361Auxin response factor 1
4ldw_B1e-1124539518361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025807170.10.0auxin response factor 15-like
SwissprotQ8S9850.0ARFO_ORYSJ; Auxin response factor 15
TrEMBLA0A2S3H9P00.0A0A2S3H9P0_9POAL; Auxin response factor
STRINGPavir.J08401.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-165ARF family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  3. Khanday I,Yadav SR,Vijayraghavan U
    Rice LHS1/OsMADS1 controls floret meristem specification by coordinated regulation of transcription factors and hormone signaling pathways.
    Plant Physiol., 2013. 161(4): p. 1970-83
    [PMID:23449645]