PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C01483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 248aa    MW: 25676.1 Da    PI: 9.2581
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C01483.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601301.1e-40601591100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf   +p+kfa+vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+aela
  Pahal.C01483.1  60 PCAACKLLRRRCAQECPFSPYFSPLEPHKFAAVHKVFGASNVSKMLLEVHESQRADAANSLVYEANLRLRDPVYGCMGAILTLQQQVQALEAELA 154
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Pahal.C01483.1 155 TVRAE 159
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.39759160IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4060157IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MSTASEWPDH ELGKKIKRES AAAAADRMTA ARRSCSLPAG AGATAAAGAG PGSALNTITP  60
CAACKLLRRR CAQECPFSPY FSPLEPHKFA AVHKVFGASN VSKMLLEVHE SQRADAANSL  120
VYEANLRLRD PVYGCMGAIL TLQQQVQALE AELATVRAEI VRHRYRPAAA AASPVATVLP  180
SSHASQLLAA SAVSRGLHLH AGRPVGTRTA TLAAASSSSS SVVYAAAAAS SSTDYSSITN  240
ENVPYFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-396016311114LOB family transfactor Ramosa2.1
5ly0_B2e-396016311114LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-140FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808904.11e-178LOB domain-containing protein 15-like isoform X1
SwissprotQ9AT612e-70LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A3L6SWK51e-119A0A3L6SWK5_PANMI; LOB domain-containing protein 15-like
STRINGPavir.J00291.1.p1e-125(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.16e-56LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]