PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C01422.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 495aa    MW: 56437.1 Da    PI: 6.9044
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C01422.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS61.51.7e-191592683115
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     + L+ cA+av+++d+ +a +lL++++++as +gd +qRla++f+++L+arl++++s++ + l +++ s    +e l+a++l+   + + k+  l 
  Pahal.C01422.1 159 TILILCAQAVAANDHMRAGELLKQIKQHASDTGDVTQRLAQCFAKGLEARLVGMGSKVWQLLMAERLS---IVEFLKAHNLYMADCSFNKVVVLF 250
                     57999******************************************************999999998...9*********************** PP

            GRAS  98 aNqaIleavegeervHii 115
                        +Il+a+ g++r+H +
  Pahal.C01422.1 251 STMTILQAMVGKRRLHTV 268
                     ****************65 PP

2GRAS148.85.2e-46267488141373
            GRAS 141 slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvks 233
                     +++iT++g p+     +e++eetg+rL+k A+e+gvpf+f++ + k++e++ +e+L+++ ++ + ++l +          + +s++d+vL+ +++
  Pahal.C01422.1 267 TVKITAIGYPHLRpcPAEQIEETGRRLSKCAHEFGVPFNFHA-IRKKWEEVCIEDLDTDAED-VLISLFF----------DDPSPKDTVLQNIRK 349
                     69*******998899***************************.7************998765.5566666..........23345689******* PP

            GRAS 234 lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328
                     ++P+v++ +  ++++ ++s+l rf eal+yy+a+fd+++a +pres+ r+++E+ ++gr + n++acega+ +er e +e+W++r ++aG++++p
  Pahal.C01422.1 350 MRPDVFIQSILNSSY-GSSYLSRFREALSYYTAMFDMFDAIIPRESKSRVVLEQDVFGRFALNIIACEGADLIERPEMYEQWQARNQRAGLRQLP 443
                     **************9.6789*************************************************************************** PP

            GRAS 329 lsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     l+  +++  k   r+++ +     e+ + l+ gW++r L + SaW
  Pahal.C01422.1 444 LEPAIVNVLKDKARQCHHKDLLFCEDGQRLLRGWMGRILCAQSAW 488
                     *****************888999999******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098528.053131469IPR005202Transcription factor GRAS
PfamPF035141.8E-43267488IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MVLPYISQML MEDDIDDTLS DHPALLQGRP ARIWYTCSGA FLEGMKEALM LLPRANGFGR  60
GELVNQMVRE SSNHNRAKKR YASNDHLEEV TRTSKSMMMI KEPEDICGHE MWDDIMSHGY  120
ETYIIRGMEK PRIAMANEVE KNSRKDSRKA VVNVVDIHTI LILCAQAVAA NDHMRAGELL  180
KQIKQHASDT GDVTQRLAQC FAKGLEARLV GMGSKVWQLL MAERLSIVEF LKAHNLYMAD  240
CSFNKVVVLF STMTILQAMV GKRRLHTVKI TAIGYPHLRP CPAEQIEETG RRLSKCAHEF  300
GVPFNFHAIR KKWEEVCIED LDTDAEDVLI SLFFDDPSPK DTVLQNIRKM RPDVFIQSIL  360
NSSYGSSYLS RFREALSYYT AMFDMFDAII PRESKSRVVL EQDVFGRFAL NIIACEGADL  420
IERPEMYEQW QARNQRAGLR QLPLEPAIVN VLKDKARQCH HKDLLFCEDG QRLLRGWMGR  480
ILCAQSAWVA EEAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-181614448328GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3YCU60.0K3YCU6_SETIT; Uncharacterized protein
STRINGSi012046m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.13e-94GRAS family protein