PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C00035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 369aa    MW: 41062.6 Da    PI: 6.7887
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C00035.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.22.3e-51111381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lp+GfrFhPtdeel+v+yL +++++ ++++  +i+ev+iy+++PwdLp+k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++l +
  Pahal.C00035.1  11 LPAGFRFHPTDEELIVHYLMNQASSLPCPV-PIIAEVNIYQCNPWDLPAKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKAILLT 104
                     799***************************.88***************8877899*************************************998 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++e++g+kk Lvfy+g+ pkg+ktdW+mheyrl
  Pahal.C00035.1 105 pTSENIGVKKALVFYSGKPPKGVKTDWIMHEYRL 138
                     89999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-636165IPR003441NAC domain
PROSITE profilePS5100558.41411165IPR003441NAC domain
PfamPF023659.9E-2612138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MPSATSRLPN LPAGFRFHPT DEELIVHYLM NQASSLPCPV PIIAEVNIYQ CNPWDLPAKA  60
LFGENEWYFF SPRDRKYPNG ARPNRAAGSG YWKATGTDKA ILLTPTSENI GVKKALVFYS  120
GKPPKGVKTD WIMHEYRLTG ANKTTKRRGS SMRLDDWVLC RIHKKSNNFQ FSDQDQEGST  180
VEEESLNNNM NGTIAASPKS EANDDHDHQF HQTTMTMSKS YSITDLLNSI DYSALSQLLD  240
APAEPDEPPL IYPTTTQTHH APLNYNNNVN RNSHFNLPQV DACSSDYVAP NNCNGLKRKR  300
VMTMDGAESS FDDGSSNSSR KLKLPSDSRS GGHSHLGSTT SSYCNQQLVD TSGFQYSSLL  360
SYPFLEMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-731017014173Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1297322RKRVMTMDGAESSFDDGSSNSSRKLK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6735450.0JN673545.1 Panicum virgatum cultivar Summer VS16 NAC transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828039.10.0NAC transcription factor 29-like
TrEMBLA0A2S3IC670.0A0A2S3IC67_9POAL; Uncharacterized protein
STRINGSi026530m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38033775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.16e-85NAC-like, activated by AP3/PI