PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B04990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 338aa    MW: 37077.5 Da    PI: 6.9065
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B04990.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.14.9e-344397155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+WtpeLHerFveav+qLGG++kAtPkti+++m+++gLtl+h+kSHLQkYRl
  Pahal.B04990.1 43 KPRLKWTPELHERFVEAVHQLGGPDKATPKTIMRIMGIPGLTLYHLKSHLQKYRL 97
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.75940100IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-324198IPR009057Homeodomain-like
SuperFamilySSF466891.31E-174298IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-244398IPR006447Myb domain, plants
PfamPF002498.5E-114596IPR001005SANT/Myb domain
PfamPF143798.7E-25142188IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MYHQQQFHGH NQHLSLRSGI PPEKQFLLQG GGDAGLVLST DAKPRLKWTP ELHERFVEAV  60
HQLGGPDKAT PKTIMRIMGI PGLTLYHLKS HLQKYRLSKN LQAQANVGSA KNGSRTGTDK  120
PCEGNGSPAS HLNIEPQINR SMHISEALQM QIEVQRQLHE QLEVQRHLQL RIEAQGKYLQ  180
SVLEKAQEAL AKQSVDLDAG VLGEAAAAET QQLSELISRA SATKRVQLEH LHHQHLGGVG  240
DGSVDSCLTA CEGSQRDHDM LSIGLSPAPT PRGGYPFEAA RSGGNDRGGA STSYEEFLFL  300
EEPGRSSSDE QQELDLTINT RRPRHCEKID LNGSSWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-204399157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-204399157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-204399157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-204399157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794611e-157HF679461.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB55 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803980.10.0myb-related protein 1-like isoform X2
SwissprotQ9FK472e-88PHLA_ARATH; Myb-related protein 1
TrEMBLA0A2S3H5280.0A0A2S3H528_9POAL; Uncharacterized protein
STRINGPavir.Ba00251.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35743879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.33e-89G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]