PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B04984.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 318aa    MW: 34838.4 Da    PI: 4.9914
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B04984.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.41.9e-55171441129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtd e+v +yL++k+ + ++++  vi++vd++k+ePwdLp+k+k +ekewyfF+++d+ky+tg r+nrat+sgyWkatgkdke+++ 
  Pahal.B04984.1  17 LPPGFRFHPTDAEVVLDYLTPKALDGTFSC-VVIADVDLNKTEPWDLPAKAKMGEKEWYFFCHKDRKYPTGMRTNRATASGYWKATGKDKEIYRG 110
                     79**************************99.78***************99999****************************************** PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +g lvg+kktLvfy+grap+gekt Wvmheyrle
  Pahal.B04984.1 111 RGVLVGMKKTLVFYTGRAPRGEKTPWVMHEYRLE 144
                     ********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-6313167IPR003441NAC domain
PROSITE profilePS5100557.58617167IPR003441NAC domain
PfamPF023651.2E-2718143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MSEVVMNPGE EEPRLVLPPG FRFHPTDAEV VLDYLTPKAL DGTFSCVVIA DVDLNKTEPW  60
DLPAKAKMGE KEWYFFCHKD RKYPTGMRTN RATASGYWKA TGKDKEIYRG RGVLVGMKKT  120
LVFYTGRAPR GEKTPWVMHE YRLEGKLPPN LPRSAKDEWA VCRVFNKDLA AKPGQMAPAA  180
GPEPTIPLDF DDIFGVPPLE DSEYAFEDLL DFKAGAGNSS SSDAAGMGGG GYQVKAEQQN  240
QQALQQGPIY FSLPAASNPG GYPHGAAEQA IRAHCRPEAP ALPSPAFAGD LSSRPYPEVD  300
DLLLDDGFID YSNMLKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5261724170NO APICAL MERISTEM PROTEIN
1ut4_B1e-5261724170NO APICAL MERISTEM PROTEIN
1ut7_A1e-5261724170NO APICAL MERISTEM PROTEIN
1ut7_B1e-5261724170NO APICAL MERISTEM PROTEIN
4dul_A1e-5261724170NAC domain-containing protein 19
4dul_B1e-5261724170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0961831e-171FP096183.1 Phyllostachys edulis cDNA clone: bphyem213g04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804669.10.0NAC domain-containing protein 87-like
SwissprotQ9FK445e-84NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A2S3H4Z90.0A0A2S3H4Z9_9POAL; Uncharacterized protein
STRINGPavir.Ba00246.1.p1e-168(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.23e-86Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]