PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B02696.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 454aa    MW: 46089.7 Da    PI: 7.2181
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B02696.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-32261314255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pahal.B02696.1 261 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 314
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15258315IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28259315IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23261314IPR006447Myb domain, plants
PfamPF002498.4E-7262313IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPSS APGSGPSGGR ATVGGAGGGG GGAGGDPWRR LNGSTASTEL  60
SLSPPAEQEH EDALPWRHRP SPAAASSAAT TSAGAALMPT MPMQQPLDGG GGGASAAAPI  120
RGIPIYNGPG GFPFLPPAAG GDGGHHQKLG FYGSYHPSTW PSSLGSTSPS PLAPGAPPAP  180
LDPASAFLSP AAHHHHRMLS ASGRLNGMLS DTLRGYGGGG MGGLGGLGGH HHHHHLHGAQ  240
PFGLGSRFMP KLPAKRSMRA PRMRWTSTLH ARFVHAVELL GGHERATPKS VLELMDVKDL  300
TLAHVKSHLQ MYRTVKSTDK PAASSGPNDG GSGDEDFPGA GQAASGGDNM CGARPFGEHR  360
STSEGAASSV GGGDMDQSSA GNTSTRWSNS SRDPWLSSNS CNMDAHRLAG LSSPIENAEP  420
CRSSSSQVSN HELSSPSLEF TLGRPDWQGA DHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9253980.0EU925398.1 Zea mays milkweed pod1 (mwp1) mRNA, complete cds.
GenBankEU9546670.0EU954667.1 Zea mays clone 1476543 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804688.10.0probable transcription factor RL9
SwissprotQ0J2351e-168ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A2S3GZH90.0A0A2S3GZH9_9POAL; Uncharacterized protein
STRINGSi032049m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-61G2-like family protein