PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B02509.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family LBD
Protein Properties Length: 355aa    MW: 37678.9 Da    PI: 6.173
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B02509.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.88.6e-39661661101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkC++dC+lapyfpa+q+++f n+h+lFG+++++k+l+ +++e+ +dam++l++++eara dPv G+v +i +lq+q+e+++ ela
  Pahal.B02509.1  66 ACAACKYQRRKCNPDCPLAPYFPADQQRRFLNAHRLFGVKKIQKTLRWIDPERGPDAMRALIFQSEARAADPVGGCVTIIEQLQRQIERTELELA 160
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++k+++
  Pahal.B02509.1 161 YVKQQI 166
                     ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.6565166IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-3666163IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MSSSSSSSAA SKPPPQPLLR LHVDTTAATT TNGSAASPGS ASSSHSSRSP RPSAAGPGGG  60
QNQNQACAAC KYQRRKCNPD CPLAPYFPAD QQRRFLNAHR LFGVKKIQKT LRWIDPERGP  120
DAMRALIFQS EARAADPVGG CVTIIEQLQR QIERTELELA YVKQQIAIYR QAAAVDPLGD  180
PAMILPAAAA VAGQDHQDNA AGAVGALYAG QEPIPPGAGI VFHDQQGYHV VKVDDQQNHR  240
PPPQQLYNYF CHDGTADDTS SSQDGSVQQY GGFADTGGLK IGSPVALGEQ LEQQCRLEAA  300
PPFVDAFDVK PQGLRATTER RGPADLVYPE DQHMEEAATA AAAPCHLELG FSSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-256719012131LOB family transfactor Ramosa2.1
5ly0_B5e-256719012131LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0053882e-50AP005388.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0086F04.
GenBankAP0149642e-50AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126162e-50CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022680048.11e-113LOB domain-containing protein 6-like
TrEMBLA0A2S3GZ980.0A0A2S3GZ98_9POAL; Uncharacterized protein
STRINGPavir.Ba02946.1.p1e-167(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-34LOB domain-containing protein 22