PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B02220.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 314aa    MW: 34184.6 Da    PI: 6.5206
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B02220.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.31.7e-3346100155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     ++rlrWt+eLHerFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Pahal.B02220.2  46 RQRLRWTNELHERFVEAVTQLGGPDRATPKGVLRIMGVPGLTIYHVKSHLQKYRL 100
                     58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.32643103IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-3245101IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1845100IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-2647101IPR006447Myb domain, plants
PfamPF002494.4E-94899IPR001005SANT/Myb domain
PfamPF143791.4E-23133178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MYSPKPEASF GSTHTNSVAN QQQMELAGNN MGPSNGANNN NNLAARQRLR WTNELHERFV  60
EAVTQLGGPD RATPKGVLRI MGVPGLTIYH VKSHLQKYRL AKYIPDASSD GNKADNKDPG  120
DLLAGLEGSS GLPISEALKL QMEVQKRLHE QLEVQRQLQL RIEAQGKYLQ KIIEEQQRLT  180
GVKSETPAAG ASVTVSSDQF PDSERTEPST PAPTSESPTQ LGASNRDTGE RTEATKSTCR  240
GDSLPRHEPL TPDSNCQNGS PPASPNHERA AKRQRGSGNE FLDAETDFSL PRNIFESSSG  300
SEFQQYSMSY SGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-2346103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-2346103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-2346103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-2346103158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0332050.0BT033205.1 Zea mays full-length cDNA clone ZM_BFb0066I21 mRNA, complete cds.
GenBankBT0398990.0BT039899.1 Zea mays full-length cDNA clone ZM_BFc0050C09 mRNA, complete cds.
GenBankBT0411540.0BT041154.1 Zea mays full-length cDNA clone ZM_BFc0181P18 mRNA, complete cds.
GenBankBT0858910.0BT085891.1 Zea mays full-length cDNA clone ZM_BFc0076P02 mRNA, complete cds.
GenBankBT0863350.0BT086335.1 Zea mays full-length cDNA clone ZM_BFc0154D10 mRNA, complete cds.
GenBankEU9764460.0EU976446.1 Zea mays clone 894637 MYB-CC type transfactor mRNA, complete cds.
GenBankJX4699000.0JX469900.1 Zea mays subsp. mays clone UT3140 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802918.10.0myb family transcription factor PHL7-like
SwissprotQ9SJW06e-98PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A2S3GYP40.0A0A2S3GYP4_9POAL; Uncharacterized protein
STRINGPavir.Ba02820.1.p0.0(Panicum virgatum)
STRINGPavir.Bb01632.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.19e-73G2-like family protein