PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B01928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family BES1
Protein Properties Length: 700aa    MW: 77405.4 Da    PI: 4.9403
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B01928.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822123.62.6e-3859135380
          DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeae 80 
                     +gr++  +E+E++k+RER+RRai+ +i+aGLR++Gny l++raD+neV++AL+reAGwvv +DGtt++ +s p+ +a+
  Pahal.B01928.1  59 QGRRRAREEKERTKLRERQRRAITGRILAGLRQHGNYSLRARADINEVIAALAREAGWVVLPDGTTFPSSSPPP-AAA 135
                     7999****************************************************************887777.333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.8E-3659141IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514452.11E-190256695IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.801.7E-207259693IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.2E-114265683IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-77296310IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-77317335IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-77339360IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060343351IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR008422.2E-8422431IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007509.3E-77432454IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-77505524IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-77539555IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-77556567IPR001554Glycoside hydrolase, family 14
PRINTSPR007509.3E-77574597IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.2E-8577587IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007509.3E-77614636IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.2E-8665679IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008422.2E-8680694IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MQQAAGPPGE DEDEEMGVKE EDDEEEEEDD GEDGCYYMDP CPVSVASPTG SGGGGRANQG  60
RRRAREEKER TKLRERQRRA ITGRILAGLR QHGNYSLRAR ADINEVIAAL AREAGWVVLP  120
DGTTFPSSSP PPAAAAAQPA PRPVMVAAAP LALPLPLPLP TSPALPLRGV PPVAARPISH  180
RPALALLPLP SVLLSPPRAA GPAASSRPPA DDVPDGDSSH LLAVPVPVAM DPATTEDAAV  240
AKQVPEVAPR PPERDFAGTP YVPVYVMLPL GVVNVNGEVV DADELVGQLR VLKAAGVDGV  300
MVDCWWGNVE AHRPQEYNWT GYKRLFQMIR ELKLKLQVVM SFHECGGNVG DDVPIPLPHW  360
VTEIGRSNPD IYFTDRTGRR NTECLSWGID KERVLQGRTA VEVYFDFMRS FRVEFDEYFE  420
DGIISEIEIG LGACGELRYP SYPAKHGWKY PGIGEFQCYD RYLQKNLRRA AEARGHTIWA  480
RGPDNAGHYN SEPNLTGFFC DGGDYDSYYG RFFLNWYSQM LVDHADRVLM LARLAFEGSS  540
IAVKVSGVHW WYKTASHAAE LTAGFYNPCN RDGYAPIAAV LKKYDAALNF TCVELRTMDQ  600
HEVYPDAFAD PEGLVWQVLN AAWDAGIQVA SENALPCYDR DGFNKILENA KPLNDPDGRH  660
LFGFTYLRLS KVLLERRNFF EFERFVKRMH GEAVLDLQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1bfn_A1e-16326169211444BETA-AMYLASE
1bya_A1e-16226169211444BETA-AMYLASE
1byb_A1e-16226169211444BETA-AMYLASE
1byc_A1e-16226169211444BETA-AMYLASE
1byd_A1e-16226169211444BETA-AMYLASE
1q6c_A1e-16326169211444beta-amylase
1wdp_A1e-16326169211444Beta-amylase
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9569050.0EU956905.1 Zea mays clone 1577050 beta-amylase mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804467.10.0beta-amylase 2, chloroplastic-like
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A2S3GXT30.0A0A2S3GXT3_9POAL; Beta-amylase
STRINGPavir.Bb01698.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21413663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7
Publications ? help Back to Top
  1. Soyk S, et al.
    The Enzyme-Like Domain of Arabidopsis Nuclear β-Amylases Is Critical for DNA Sequence Recognition and Transcriptional Activation.
    Plant Cell, 2014. 26(4): p. 1746-1763
    [PMID:24748042]