PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B00461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 775aa    MW: 83465.1 Da    PI: 6.6661
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B00461.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.34.9e-16460498240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Pahal.B00461.1 460 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 498
                     589**********************************96 PP

2TCR50.25e-16545584140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  Pahal.B00461.1 545 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 584
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17459500IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.046460585IPR005172CRC domain
PfamPF036388.7E-12462497IPR005172CRC domain
SMARTSM011143.5E-16545586IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11547583IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MDTPDRAAAQ QPPASRAEDS PVFSFINNLS PIEPLKSAYN ANSLQGYQSI NITSISSIFT  60
SPHDNVHKET RLAKSSLGEI SESEASAGGS KTNKPARSSN AVRLFACTST ITQETHTVTC  120
SDVADPPTGP CDLAQPAQFD NGSPDHNTTP CHGVRSDLKQ DKCRKLDAVQ AVKNTVEKRK  180
CLFSTEIQLL DGGQPVNDSD DVLGCEWSDL ISTTSGELLA FDSTMDDHHR GMHLAAKNAE  240
SCGYLLSKLT GDSEISGRAH PSASGQVYYQ ELVMGEDQTE NPQIFQDGQQ TISTEEIQDN  300
IYEPNGCIPL DYKVESQQRG IRRRCLVFEA AGFSNTVVQK ETVESLSVST CKGKSHVQTQ  360
PRGLRGIGLH LNALALTPKG KMASQDHMAS GLRPSLAEKD VHGKFLSAGE NFPNSGGELL  420
EFPMDDCSAG GFPVNDHVSS QSVSPQKKRR KTDNGDDGEA CKRCSCKKSK CLKLYCECFA  480
AGVYCSEPCS CQGCLNKPIH EEIVLSTRKQ IEFRNPLAFA PKVIRMSDAG PETGEDPNST  540
PASARHKRGC NCKKSSCLKK YCECYQGGVG CSSNCRCESC KNTFGRRDAD SELIEEIKQE  600
GEQTENCGKE KENDQQKANV QNEDHPLLDL VPITPPFDLS SSLLKLPNFS SAKPPRPSKA  660
RSGNYRSSAS KATATLQSCK SSKVAGSAID EGMPDILKEA DSPNNCVKTT SPNGKRVSPP  720
HNALSISPNR KGGRKLILKS IPSFPSLMGE SNSGSAMNDT DNTFNASPLV LGPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1546258212120Protein lin-54 homolog
5fd3_B3e-1546258212120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1446450KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799594.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A2S3GWC50.0A0A2S3GWC5_9POAL; Uncharacterized protein
STRINGPavir.Bb00411.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.17e-87TESMIN/TSO1-like CXC 2