PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B00269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 1031aa    MW: 113602 Da    PI: 10.05
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B00269.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.6e-08397442146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r +WT++E+ +l+  v++ G+ +W  Ia t+g+ Rt+ qc  r+q 
   Pahal.B00269.1 397 REAWTAQEETKLLLIVQEKGMYNWINIAVTLGTYRTPFQCLVRYQR 442
                      789*****************************99*******99995 PP

2Myb_DNA-binding45.91.3e-14451495248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++WT+eEd++l  av+ +G + W ++++ +  gRt++qc +rw+k l
   Pahal.B00269.1 451 KAWTKEEDLQLQAAVETFGEK-WQLVSASLD-GRTGNQCSNRWRKTL 495
                      58*******************.*********.************975 PP

3Myb_DNA-binding34.93.7e-11503547247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      grW  +Ed++l   vk+ G+g+W++Ia  ++ gRt  qc +rw + 
   Pahal.B00269.1 503 GRWHMDEDKRLMVSVKLIGSGSWSRIAPFIP-GRTQTQCHERWCNI 547
                      89*****************************.***********996 PP

4Myb_DNA-binding46.86.9e-15555598247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+W +eEd +l+ av ++G+  W++Ia +++ gR +++c  rw+k+
   Pahal.B00269.1 555 GKWRPEEDSKLLAAVSEFGPC-WSKIAMMIP-GRNDNMCSRRWNKL 598
                      79*****************88.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.866293389IPR017877Myb-like domain
SMARTSM007171.5E-4297393IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-11299316IPR009057Homeodomain-like
CDDcd001670.00135362389No hitNo description
Gene3DG3DSA:1.10.10.601.3E-11363404IPR009057Homeodomain-like
SuperFamilySSF466892.75E-14373441IPR009057Homeodomain-like
PROSITE profilePS500908.606392444IPR017877Myb-like domain
SMARTSM007174.5E-6396446IPR001005SANT/Myb domain
PfamPF002491.1E-5397442IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-11405450IPR009057Homeodomain-like
SuperFamilySSF466892.37E-21429498IPR009057Homeodomain-like
PROSITE profilePS5129418.195445499IPR017930Myb domain
SMARTSM007176.7E-13449497IPR001005SANT/Myb domain
PfamPF002493.3E-13451494IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-17451497IPR009057Homeodomain-like
CDDcd001678.35E-11452495No hitNo description
PROSITE profilePS500909.93497548IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.7E-16500548IPR009057Homeodomain-like
SuperFamilySSF466891.72E-24500595IPR009057Homeodomain-like
SMARTSM007172.0E-7501550IPR001005SANT/Myb domain
PfamPF002496.1E-10503548IPR001005SANT/Myb domain
CDDcd001673.38E-7504548No hitNo description
Gene3DG3DSA:1.10.10.606.1E-19549602IPR009057Homeodomain-like
PROSITE profilePS5129421.463549603IPR017930Myb domain
SMARTSM007178.2E-13553601IPR001005SANT/Myb domain
PfamPF002495.7E-13555598IPR001005SANT/Myb domain
CDDcd001671.47E-11556598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1031 aa     Download sequence    Send to blast
MDFYSDDSDP DIDEDLREDL DALRRSCILS GADPDAAVAQ VSSACLAGPS TPALAAAGGN  60
DGLSSDDDED LALVRSIREN LHRLNRASPG DAAGGGDASS SPRPICTWPP SDTDEDEDDL  120
ETLRAIQRRF SHYHSSTSTT SPKTMKPEAS QGVHSELFAD RNDDEFAAHK QNTKAPNRTG  180
FPKAALLLVD ALKKNRACQK FIRRKLINIE AKIEENKDLG DRVKCLLGYQ LSCRRSASRT  240
LSQKEDPRVR LISSRKPTRL SEKNNNRKMP ALFLGPAENP HVSKYKMVLE QFPMSFKKQP  300
WSDVEKDKLA RGIKQQYQET LILDSLNNGS AIGDFSAVDM AYALTNAAGN FEVTPESLRS  360
VLPLINWDKI SAMYLPGRSG AECESRWLNC DDPLINREAW TAQEETKLLL IVQEKGMYNW  420
INIAVTLGTY RTPFQCLVRY QRSLNPHIMN KAWTKEEDLQ LQAAVETFGE KWQLVSASLD  480
GRTGNQCSNR WRKTLHPTRT RVGRWHMDED KRLMVSVKLI GSGSWSRIAP FIPGRTQTQC  540
HERWCNILDP NIDLGKWRPE EDSKLLAAVS EFGPCWSKIA MMIPGRNDNM CSRRWNKLCK  600
HQLPAVKAAI QLKKSVFQTN FVDRAKERPA IAPSDLIALV QSKDDGSGEN TRDRSRKQTK  660
ENLAVSNIVT SSTAPDFVAP DTVSNTISRR PRRKSTGQKS KKQTEENVAV PDGLNGLSSG  720
CSRSRKRKST TGSNAAVQKR MRGSISLDNE AVPIELRGTD SANNAVGTNR IMDPVSVGEE  780
GVVQKRTSPS KPARGNSAEQ KIMTGSIPVG IEAVPIELRG TVSTNNEVGT NTMMDPVSIG  840
DGGVVKKRTT RSKPAGSEGA TRKRRCSISA DNEAGTNMMR DPVSGEEGVV KKRMRRSKPV  900
GNYGAARKTM RASVPVGDEG VVKKRTGSVT TENHGGVTKR KRAPSRRKSA GDNLTAEDVA  960
KASPELGLPS TRSEERVVDA GNIDKGRRKS TPRPKQIDMS EGDADKHSPS TRLANCLSFA  1020
RMKGTDRNRR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-273695963155MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-273695963155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1689693RPRRK
2723728SRKRKS
3889895VKKRMRR
4922941KKRTGSVTTENHGGVTKRKR
510201029RMKGTDRNRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660280.10.0PREDICTED: uncharacterized protein LOC101780859
TrEMBLA0A096QN110.0A0A096QN11_MAIZE; Uncharacterized protein
STRINGGRMZM2G051793_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-145myb domain protein 4r1